TPGS2 Antibody

Images

 
Western Blot: TPGS2 Antibody [NBP2-57557] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: TPGS2 Antibody [NBP2-57557] - Staining of human cell line U-2 OS shows localization to nucleoli.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TPGS2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TQLTQSSMYSLPNAPTLADLEDDTHEASDDQPEKPHFDSRSVIFELDSCNGSGKVCLVYKSGKPALAEDTEIWFLDRALYWHFL
Specificity
Specificity of human TPGS2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TPGS2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control
TPGS2 Knockout HeLa Cell Lysate
Control Peptide
TPGS2 Recombinant Protein Antigen (NBP2-57557PEP)

Reactivity Notes

Mouse 84%, Rat 81%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for TPGS2 Antibody

  • chromosome 18 open reading frame 10
  • DKFZp586M1523
  • HsT3006
  • L17
  • PGs2
  • tubulin polyglutamylase complex subunit 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87847
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB7158
Species: Hu, Mu
Applications: WB, IHC
NBP1-80104
Species: Hu
Applications: WB
NBP1-83192
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-94118
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-80959
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20212
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13251
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00029956-M01A
Species: Hu, Mu
Applications: WB, ELISA, IHC
NBP2-20214
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-06069
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-06930
Species: Hu
H00006124-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP2-93953
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-22288
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-88446
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20210
Species: Hu, Mu, I
Applications: WB, IHC, IHC-P
NBP1-84744
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-57557
Species: Hu
Applications: WB, ICC/IF

Publications for TPGS2 Antibody (NBP2-57557) (0)

There are no publications for TPGS2 Antibody (NBP2-57557).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TPGS2 Antibody (NBP2-57557) (0)

There are no reviews for TPGS2 Antibody (NBP2-57557). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TPGS2 Antibody (NBP2-57557) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TPGS2 Products

Bioinformatics Tool for TPGS2 Antibody (NBP2-57557)

Discover related pathways, diseases and genes to TPGS2 Antibody (NBP2-57557). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on TPGS2

There are no specific blogs for TPGS2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TPGS2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TPGS2