Recombinant Human TPD52L2/D54 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human TPD52L2/D54 Protein [H00007165-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human TPD52L2/D54 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-206 of Human TPD52L2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MDSAGQDINLNSPNKGLLSDSMTDVPVDTGVAARTPAVEGLTEAEEEELRAELTKVEEEIVTLRQVLAAKERHCGELKRRLGLSTLGELKQNLSRSWHDVQVSSAYVKTSEKLGEWNEKVTQSDLYKKTQETLSQAGQKTSAALSTVGSAISRKLGDMRNSATFKSFEDRVGTIKSKVVGDRENGSDNLPSSAGSGDKPLSDPAPF

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
TPD52L2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
48.29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TPD52L2/D54 GST (N-Term) Protein

  • DKFZp686A1765
  • HCCR-binding protein 2
  • tumor protein D52-like 2hD54D54
  • tumor protein D54

Background

TPD52L2( AAH06804, 1 a.a. - 207 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38952
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84313
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
H00005241-M08
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-90256
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00027065-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP2-31896
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-33283
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67334
Species: Hu, Mu, Rt, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-74267
Species: Hu
Applications: WB
NBP2-15252
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-27202
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Fe, Ma-Op, Pm
Applications: WB, Simple Western, ICC/IF

Publications for TPD52L2/D54 Recombinant Protein (H00007165-P01) (0)

There are no publications for TPD52L2/D54 Recombinant Protein (H00007165-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TPD52L2/D54 Recombinant Protein (H00007165-P01) (0)

There are no reviews for TPD52L2/D54 Recombinant Protein (H00007165-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TPD52L2/D54 Recombinant Protein (H00007165-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional TPD52L2/D54 Products

Bioinformatics Tool for TPD52L2/D54 Recombinant Protein (H00007165-P01)

Discover related pathways, diseases and genes to TPD52L2/D54 Recombinant Protein (H00007165-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TPD52L2/D54 Recombinant Protein (H00007165-P01)

Discover more about diseases related to TPD52L2/D54 Recombinant Protein (H00007165-P01).
 

Pathways for TPD52L2/D54 Recombinant Protein (H00007165-P01)

View related products by pathway.

Blogs on TPD52L2/D54

There are no specific blogs for TPD52L2/D54, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TPD52L2/D54 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TPD52L2