Recombinant Human TPD52 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human TPD52 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 100-184 of Human TPD52 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:SETLSQAGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEKVENLKSKVGGTKPAGGDFGEVLNSAANASATTTEPLPEKTQESL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
TPD52

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TPD52 Protein

  • D52
  • hD52
  • N8L
  • PC-1
  • PrLZ
  • prostate and colon associated protein
  • prostate leucine zipper
  • Protein N8
  • tumor protein D52

Background

TPD52 - tumor protein D52

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-84313
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27561
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-12793
Species: Hu, Mu
Applications: WB, IP
AF6270
Species: Hu
Applications: ICC
MAB5756
Species: Hu
Applications: Flow
NBP2-29950
Species: Hu, Mu
Applications: WB, Flow, IHC-P
NBP1-32162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-13468
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80944
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-71805
Species: Hu
Applications: WB, IP
NBP2-45538
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-87789
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-47836
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB120-19294
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00007163-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for TPD52 Partial Recombinant Protein (H00007163-Q01) (0)

There are no publications for TPD52 Partial Recombinant Protein (H00007163-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TPD52 Partial Recombinant Protein (H00007163-Q01) (0)

There are no reviews for TPD52 Partial Recombinant Protein (H00007163-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TPD52 Partial Recombinant Protein (H00007163-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TPD52 Products

Bioinformatics Tool for TPD52 Partial Recombinant Protein (H00007163-Q01)

Discover related pathways, diseases and genes to TPD52 Partial Recombinant Protein (H00007163-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TPD52 Partial Recombinant Protein (H00007163-Q01)

Discover more about diseases related to TPD52 Partial Recombinant Protein (H00007163-Q01).
 

Pathways for TPD52 Partial Recombinant Protein (H00007163-Q01)

View related products by pathway.

PTMs for TPD52 Partial Recombinant Protein (H00007163-Q01)

Learn more about PTMs related to TPD52 Partial Recombinant Protein (H00007163-Q01).
 

Research Areas for TPD52 Partial Recombinant Protein (H00007163-Q01)

Find related products by research area.

Blogs on TPD52

There are no specific blogs for TPD52, but you can read our latest blog posts.

Customers Who Bought This Also Bought

TPD52 Antibody
NBP2-38952

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TPD52 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TPD52