TPD52 Antibody

Images

 
Western Blot: TPD52 Antibody [H00007163-D01P] - Analysis of TPD52 expression in transfected 293T cell line by TPD52 polyclonal antibody.Lane 1: TPD52 transfected lysate(20.24 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TPD52 Antibody Summary

Immunogen
TPD52 (AAH18117.1, 1 a.a. - 184 a.a.) full-length human protein. MDRGEQGLLRTDPVPEEGEDVAATISATETLSEEEQEELRRELAKVEEEIQTLSQVLAAKEKHLAEIKRKLGINSLQELKQNIAKGWQDVTATSAYKKTSETLSQAGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEKVENLKSKVGGTKPAGGDFGEVLNSAANASATTTEPLPEKTQESL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TPD52
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TPD52 Antibody

  • D52
  • hD52
  • N8L
  • PC-1
  • PrLZ
  • prostate and colon associated protein
  • prostate leucine zipper
  • Protein N8
  • tumor protein D52

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-84313
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27561
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-12793
Species: Hu, Mu
Applications: WB, IP
AF6270
Species: Hu
Applications: ICC
MAB5756
Species: Hu
Applications: Flow
NBP2-29950
Species: Hu, Mu
Applications: WB, Flow, IHC-P
NBP1-32162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-13468
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80944
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-71805
Species: Hu
Applications: WB, IP
NBP2-45538
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-87789
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-47836
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB120-19294
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00007163-D01P
Species: Hu
Applications: WB

Publications for TPD52 Antibody (H00007163-D01P) (0)

There are no publications for TPD52 Antibody (H00007163-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TPD52 Antibody (H00007163-D01P) (0)

There are no reviews for TPD52 Antibody (H00007163-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TPD52 Antibody (H00007163-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TPD52 Products

Bioinformatics Tool for TPD52 Antibody (H00007163-D01P)

Discover related pathways, diseases and genes to TPD52 Antibody (H00007163-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TPD52 Antibody (H00007163-D01P)

Discover more about diseases related to TPD52 Antibody (H00007163-D01P).
 

Pathways for TPD52 Antibody (H00007163-D01P)

View related products by pathway.

PTMs for TPD52 Antibody (H00007163-D01P)

Learn more about PTMs related to TPD52 Antibody (H00007163-D01P).
 

Research Areas for TPD52 Antibody (H00007163-D01P)

Find related products by research area.

Blogs on TPD52

There are no specific blogs for TPD52, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TPD52 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TPD52
Uniprot