Recombinant Human TORC1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human TORC1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 553-634 of Human CRTC1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:ASHSGIPNIILTVTGESPPSLSKELTSSLAGVGDVSFDSDSQFPLDELKIDPLTLDGLHMLNDPDMVLADPATEDTFRMDRL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
CRTC1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TORC1 Protein

  • CREB regulated transcription coactivator 1
  • CRTC1
  • FLJ14027WAMTP1
  • KIAA0616Transducer of regulated cAMP response element-binding protein 1
  • MECT1
  • MECT1CREB-regulated transcription coactivator 1
  • mucoepidermoid carcinoma translocated 1
  • Mucoepidermoid carcinoma translocated protein 1
  • TORC1
  • TORC1TORC-1
  • Transducer of CREB protein 1
  • transducer of regulated cAMP response element-binding protein (CREB) 1
  • WAMTP1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NBP2-22356
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-24449
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-410
Species: Hu, Mu
Applications: WB, IP
NB100-1595
Species: Hu, Mu
Applications: WB, IHC-P, IP
MAB40401
Species: Hu, Mu
Applications: WB, IHC, ICC
NB100-331
Species: Hu, Mu, Rt
Applications: IP (-), WB
NBP2-46234
Species: Hu
Applications: WB, IHC
NBP2-47649
Species: Hu
Applications: WB, Flow, IHC-P, PAGE, IF
NBP2-46403
Species: Hu
Applications: IHC
NBP1-87799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF8962
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NB100-611
Species: Hu
Applications: WB, IP
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46404
Species: Hu
Applications: IHC, IHC-P
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB200-157
Species: Hu
Applications: WB, IHC, IHC-P

Publications for TORC1 Partial Recombinant Protein (H00023373-Q01) (0)

There are no publications for TORC1 Partial Recombinant Protein (H00023373-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TORC1 Partial Recombinant Protein (H00023373-Q01) (0)

There are no reviews for TORC1 Partial Recombinant Protein (H00023373-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TORC1 Partial Recombinant Protein (H00023373-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TORC1 Products

Bioinformatics Tool for TORC1 Partial Recombinant Protein (H00023373-Q01)

Discover related pathways, diseases and genes to TORC1 Partial Recombinant Protein (H00023373-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TORC1 Partial Recombinant Protein (H00023373-Q01)

Discover more about diseases related to TORC1 Partial Recombinant Protein (H00023373-Q01).
 

Pathways for TORC1 Partial Recombinant Protein (H00023373-Q01)

View related products by pathway.

PTMs for TORC1 Partial Recombinant Protein (H00023373-Q01)

Learn more about PTMs related to TORC1 Partial Recombinant Protein (H00023373-Q01).
 

Research Areas for TORC1 Partial Recombinant Protein (H00023373-Q01)

Find related products by research area.

Blogs on TORC1

There are no specific blogs for TORC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

BDNF [Unconjugated]
248-BD-005/CF
TORC1 Antibody
NBP1-89865
4EBP1 Antibody
NB200-157

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TORC1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CRTC1
Entrez