Topoisomerase I Antibody [Alexa Fluor® 405]

Images

 

Product Details

Summary
Product Discontinued
View other related Topoisomerase I Primary Antibodies

Order Details


    • Catalog Number
      NBP3-35246AF405
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Topoisomerase I Antibody [Alexa Fluor® 405] Summary

Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Topoisomerase I (Topoisomerase I (TOP1)) (NP_003277.1).

Sequence:
MSGDHLHNDSQIEADFRLNDSHKHKDKHKDREHRHKEHKKEKDREKSKHSNSEHKDSEKKHKEKEKTKHKDGSSEKHKDKHKDRDKEKRKEEKVRASGDA
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TOP1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation
  • Western Blot
Application Notes
Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
Affinity purified

Notes



Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Alternate Names for Topoisomerase I Antibody [Alexa Fluor® 405]

  • DNA topoisomerase 1
  • DNA topoisomerase I
  • EC 5.6.2.1
  • EC 5.99.1.2
  • TOP1
  • TOPI
  • topoisomerase (DNA) I
  • Topoisomerase I
  • type I DNA topoisomerase

Background

Topoisomerases are nuclear enzymes involved in a variety of cellular activities such as chromosome condensation, DNA replication, transcription, recombination and segregation at mitosis. Human topoisomerase I is a 100kD protein capable of relaxing positively and negatively supercoiled DNA by performing a transient single stranded nick which is then religated at the end of the reaction. It has been shown that the enzyme is located in regions of the genome that are undergoing active RNA synthesis, where it probably reduces superhelical stresses in the DNA, enabling RNA polymerase to function properly. Both DNA topoisomerases I and II have been found to be targets of autoantibodies in the sera of patients with certain autoimmune diseases such as systemic lupus erythematosus and also of some anti tumor drugs and antibiotics. Elevated levels of DNA topoisomerase I, detected by transfer assays, have been demonstrated in colorectal tumors compared with normal colon mucosa as a result of increased transcription or mRNA stability.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87964
Species: Hu
Applications: IHC,  IHC-P
NBP2-92299
Species: Hu
Applications: WB
NB100-81642
Species: Hu
Applications: IHC,  IHC-P, IP, WB
NBP1-86928
Species: Hu
Applications: IHC,  IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NB100-309
Species: Hu, Pm, Mu, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC,  IHC-P, IP, KD, PAGE, Single-Cell Western, WB
NBP2-22124
Species: Hu, Mu, Pm
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-27335
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, WB
NBP2-71688
Species: Ca, Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-88899
Species: Hu
Applications: IHC,  IHC-P
NBP3-41251
Species: Hu
Applications: IHC,  IHC-P, WB
NB100-93325
Species: Hu
Applications: ICC/IF, IP, WB
NBP2-67667
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-58116
Species: Hu
Applications: ICC/IF, KD, WB
NBP1-69023
Species: Mu
Applications: WB

Publications for Topoisomerase I Antibody (NBP3-35246AF405) (0)

There are no publications for Topoisomerase I Antibody (NBP3-35246AF405).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Topoisomerase I Antibody (NBP3-35246AF405) (0)

There are no reviews for Topoisomerase I Antibody (NBP3-35246AF405). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Topoisomerase I Antibody (NBP3-35246AF405) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Topoisomerase I Products

Research Areas for Topoisomerase I Antibody (NBP3-35246AF405)

Find related products by research area.

Blogs on Topoisomerase I

There are no specific blogs for Topoisomerase I, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Topoisomerase I Antibody [Alexa Fluor® 405] and receive a gift card or discount.

Bioinformatics

Gene Symbol TOP1