We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

TOP2B Recombinant Protein Antigen

Images

 
There are currently no images for TOP2B Recombinant Protein Antigen (NBP2-58728PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TOP2B Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TOP2B.

Source: E. coli

Amino Acid Sequence: DKVPSKTVAAKKGKPSSDTVPKPKRAPKQKKVVEAVNSDSDSEFGIPKKTTTPKGKGRGAKKRKASGSENEGDYNPGRKTSKTTSKKPKKTSFDQDSDVDIFPSDFPTEPPSLPRTGRARKEVKYFAESDEEEDDVDF

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TOP2B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58728.It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TOP2B Recombinant Protein Antigen

  • antigen MLAA-44
  • DNA topoisomerase 2-beta
  • DNA topoisomerase II beta
  • DNA topoisomerase II, 180 kD
  • DNA topoisomerase II, beta isozyme
  • EC 5.99.1.3
  • TOP2B
  • top2beta
  • TOPIIB
  • topo II beta
  • topoisomerase (DNA) II beta (180kD)
  • topoisomerase (DNA) II beta 180kDa
  • topoisomerase II beta
  • topoisomerase IIb
  • U937 associated antigen

Background

Topo II Beta antibody plays important roles in synthesis and transcription of DNA as well as chromosomal segregation during mitosis. It is present ubiquitously in normal cells and is upregulated in tumors and proliferating cells. Further, it is implicated in drug resistance of tumor cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-53281
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, PA, WB
NBP2-27335
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-67667
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NB400-156
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IP, Simple Western, WB
NBP1-82820
Species: Hu
Applications: ICC/IF,  IHC-P, Simple Western, WB
NBP2-38160
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP3-46186
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IP, WB
NBP2-13415
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC,  IHC-P, WB
NB300-221
Species: Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, Sh, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Simple Western, Single-Cell Western, WB
1129-ER
Species: Hu
Applications: BA
NBP2-43728
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP2-45516
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-98903
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P
NBP1-28566
Species: Bv, Hu, Pm, Mu, Po, Rt
Applications: Func, IHC, IHC-Fr,  IHC-P, WB

Publications for TOP2B Recombinant Protein Antigen (NBP2-58728PEP) (0)

There are no publications for TOP2B Recombinant Protein Antigen (NBP2-58728PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TOP2B Recombinant Protein Antigen (NBP2-58728PEP) (0)

There are no reviews for TOP2B Recombinant Protein Antigen (NBP2-58728PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TOP2B Recombinant Protein Antigen (NBP2-58728PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TOP2B Products

Research Areas for TOP2B Recombinant Protein Antigen (NBP2-58728PEP)

Find related products by research area.

Blogs on TOP2B

There are no specific blogs for TOP2B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

TOP2B Antibody
NB100-40842

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TOP2B Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TOP2B