TOMM5 Recombinant Protein Antigen

Images

 
There are currently no images for TOMM5 Protein (NBP2-14654PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TOMM5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TOMM5.

Source: E.coli

Amino Acid Sequence: RIEGLAPKLDPEEMKRKMREDVISSIRNFLIYVALLRVTPFILKKLD

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TOMM5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-14654.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for TOMM5 Recombinant Protein Antigen

  • bA613M10.3
  • C9orf105
  • RP11-263I4.1
  • Tom5
  • TOMM5 translocase of outer mitochondrial membrane 5 homolog (yeast)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38289
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81556
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-92298
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-65485
Species: Hu
NBP1-80671
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB8864
Species: Hu
Applications: IHC
AF3145
Species: Hu
Applications: WB
NBP1-58301
Species: Hu, Mu, Rt, Bv, Ca, Eq, Gt, GP, Rb, Sh, Ze
Applications: WB
NBP1-80681
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-42187
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, ICC
NB100-40853
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-76701
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, KD
H00006901-M12
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP1-31470
Species: Hu, Mu, Rt, Bv, Vi
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-23000
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ca, Ch, ChHa, Eq, Fe, Ha, Op, Pm, Rb, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Single Cell Western
NBP1-88985
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14654PEP
Species: Hu
Applications: AC

Publications for TOMM5 Protein (NBP2-14654PEP) (0)

There are no publications for TOMM5 Protein (NBP2-14654PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TOMM5 Protein (NBP2-14654PEP) (0)

There are no reviews for TOMM5 Protein (NBP2-14654PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TOMM5 Protein (NBP2-14654PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional TOMM5 Products

Array NBP2-14654PEP

Bioinformatics Tool for TOMM5 Protein (NBP2-14654PEP)

Discover related pathways, diseases and genes to TOMM5 Protein (NBP2-14654PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TOMM5 Protein (NBP2-14654PEP)

Discover more about diseases related to TOMM5 Protein (NBP2-14654PEP).
 

Pathways for TOMM5 Protein (NBP2-14654PEP)

View related products by pathway.

PTMs for TOMM5 Protein (NBP2-14654PEP)

Learn more about PTMs related to TOMM5 Protein (NBP2-14654PEP).

Blogs on TOMM5

There are no specific blogs for TOMM5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

TOMM20 Antibody
NBP1-81556

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TOMM5 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TOMM5