Recombinant Human TOMM40 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human TOMM40 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 276-361 of Human TOMM40 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:HKASDQLQVGVEFEASTRMQDTSVSFGYQLDLPKANLLFKGSVDSNWIVGATLEKKLPPLPLTLALGAFLNHRKNKFQCGFGLTIG

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
TOMM40

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TOMM40 Protein

  • C19orf1mitochondrial import receptor subunit TOM40 homolog
  • D19S1177E
  • mitochondrial outer membrane protein
  • PER-EC1
  • PEREC1Translocase of outer membrane 40 kDa subunit homolog
  • Protein Haymaker
  • TOM40p38.5
  • translocase of outer mitochondrial membrane 40 homolog (yeast)

Background

TOMM40 - translocase of outer mitochondrial membrane 40 homolog (yeast)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92298
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-80671
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81556
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-695
Species: Hu, Mu, Rt, Po, Av, Bv, Fi, Gt, Ma, Re
Applications: WB, ELISA, IHC
NB110-58347
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF
NBP1-80681
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-17193
Species: Hu
NBP1-84509
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00000341-M01
Species: Hu
Applications: WB, ELISA
MAB8864
Species: Hu
Applications: IHC
NBP1-89771
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF3145
Species: Hu
Applications: WB
AF5228
Species: Hu
Applications: WB
NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-40853
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-31470
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00010452-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for TOMM40 Partial Recombinant Protein (H00010452-Q01) (0)

There are no publications for TOMM40 Partial Recombinant Protein (H00010452-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TOMM40 Partial Recombinant Protein (H00010452-Q01) (0)

There are no reviews for TOMM40 Partial Recombinant Protein (H00010452-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TOMM40 Partial Recombinant Protein (H00010452-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TOMM40 Products

Bioinformatics Tool for TOMM40 Partial Recombinant Protein (H00010452-Q01)

Discover related pathways, diseases and genes to TOMM40 Partial Recombinant Protein (H00010452-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TOMM40 Partial Recombinant Protein (H00010452-Q01)

Discover more about diseases related to TOMM40 Partial Recombinant Protein (H00010452-Q01).
 

Pathways for TOMM40 Partial Recombinant Protein (H00010452-Q01)

View related products by pathway.

PTMs for TOMM40 Partial Recombinant Protein (H00010452-Q01)

Learn more about PTMs related to TOMM40 Partial Recombinant Protein (H00010452-Q01).

Blogs on TOMM40

There are no specific blogs for TOMM40, but you can read our latest blog posts.

Customers Who Bought This Also Bought

TOMM40 Antibody
NBP2-38289
TOMM20 Antibody
NBP1-81556

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TOMM40 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TOMM40