TOB2 Antibody (2F2-1A7) Summary
| Immunogen |
TOB2 (AAH38957, 1 a.a. ~ 345 a.a) full length recombinant protein with GST tag.MQLEIKVALNFIISYLYNKLPRRRADLFGEELERLLKKKYEG
HWYPEKPLKGSGFRCVHIGEMVDPVVELAAKRSGLAVEDVRA
NVPEELSVWIDPFEVSYQIGEKGAVKVLYLDDSEGCGAPELD
KEIKSSFNPDAQVFVPIGSQDSSLSNSPSPSFGQSPSPTFIP
RSAQPITFTTASFAATKFGSTKMKKGGGAASGGGVASSGAGG
QQPPQQPRMARSPTNSLLKHKSLSLSMHSLNFITA |
| Localization |
Cytoplasm |
| Specificity |
TOB2 - transducer of ERBB2, 2 |
| Isotype |
IgG2b Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
TOB2 |
| Purity |
Ascites |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
Antibody reactive against transfected lysate and recombinant protein for western blot. It has also been used for ELISA. |
Reactivity Notes
Human. Other species not tested.
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.4) |
| Preservative |
No Preservative |
| Purity |
Ascites |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for TOB2 Antibody (2F2-1A7)
Background
TOB2 belongs to the TOB (see TOB1; MIM 605523)/BTG1 (MIM 109580) family of antiproliferative proteins, which are involved in the regulation of cell cycle progression.[supplied by OMIM]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IP, WB
Species: Hu
Applications: ICC/IF, IP, KD, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Bv, Ca, Dr(-), Hu, Mu(-), Pm, Xp
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IP, MiAr, WB
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-reported, Flow
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Pm, Mu, Pm, Rt, Sh
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ELISA
Publications for TOB2 Antibody (H00010766-M01) (0)
There are no publications for TOB2 Antibody (H00010766-M01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for TOB2 Antibody (H00010766-M01) (0)
There are no reviews for TOB2 Antibody (H00010766-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for TOB2 Antibody (H00010766-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional TOB2 Products
Research Areas for TOB2 Antibody (H00010766-M01)
Find related products by research area.
|
Blogs on TOB2