TOB2 Antibody (2F2-1A7)

Images

 
Western Blot: TOB2 Antibody (2F2-1A7) [H00010766-M01] - Analysis of TOB2 expression in transfected 293T cell line by TOB2 monoclonal antibody (M01), clone 2F2-1A7.Lane 1: TOB2 transfected lysate(36.6 KDa).Lane 2: ...read more
Sandwich ELISA: TOB2 Antibody (2F2-1A7) [H00010766-M01] - Detection limit for recombinant GST tagged TOB2 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2F2-1A7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TOB2 Antibody (2F2-1A7) Summary

Immunogen
TOB2 (AAH38957, 1 a.a. ~ 345 a.a) full length recombinant protein with GST tag.MQLEIKVALNFIISYLYNKLPRRRADLFGEELERLLKKKYEG HWYPEKPLKGSGFRCVHIGEMVDPVVELAAKRSGLAVEDVRA NVPEELSVWIDPFEVSYQIGEKGAVKVLYLDDSEGCGAPELD KEIKSSFNPDAQVFVPIGSQDSSLSNSPSPSFGQSPSPTFIP RSAQPITFTTASFAATKFGSTKMKKGGGAASGGGVASSGAGG QQPPQQPRMARSPTNSLLKHKSLSLSMHSLNFITA
Localization
Cytoplasm
Specificity
TOB2 - transducer of ERBB2, 2
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TOB2
Purity
Ascites
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
Application Notes
Antibody reactive against transfected lysate and recombinant protein for western blot. It has also been used for ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Ascites

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TOB2 Antibody (2F2-1A7)

  • bK223H9
  • protein Tob2
  • Protein Tob4
  • TOB4KIAA1663
  • TOBL
  • Transducer of erbB-2 2
  • transducer of ERBB2, 2
  • TROB2

Background

TOB2 belongs to the TOB (see TOB1; MIM 605523)/BTG1 (MIM 109580) family of antiproliferative proteins, which are involved in the regulation of cell cycle progression.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81215
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5228
Species: Hu
Applications: WB
NBP2-46586
Species: Hu
Applications: IHC
H00054766-M07
Species: Hu
Applications: WB, ELISA, ICC/IF
H00029883-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-89098
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-15930
Species: Hu
Applications: WB, ICC/IF
H00005122-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-83224
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15275
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-207
Species: Hu
Applications: WB, ICC/IF, IP
NB500-212
Species: Hu
Applications: WB, ICC/IF, IP
NBP1-86564
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB120-6125
Species: Hu, Bv, Ca, Pm, Xp, Dr(-), Mu(-)
Applications: WB, ELISA, Flow, ICC/IF, IP, MiAr, CyTOF-ready
NBP2-37856
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
MAB1567
Species: Hu
Applications: Flow, CyTOF-reported
PP-H4537-00
Species: Hu
Applications: WB, IHC, IP, DirELISA
NB100-56440
Species: Hu, Mu, Rt, Pm, Sh
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-84186
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for TOB2 Antibody (H00010766-M01) (0)

There are no publications for TOB2 Antibody (H00010766-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TOB2 Antibody (H00010766-M01) (0)

There are no reviews for TOB2 Antibody (H00010766-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TOB2 Antibody (H00010766-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TOB2 Products

Bioinformatics Tool for TOB2 Antibody (H00010766-M01)

Discover related pathways, diseases and genes to TOB2 Antibody (H00010766-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TOB2 Antibody (H00010766-M01)

Discover more about diseases related to TOB2 Antibody (H00010766-M01).
 

Pathways for TOB2 Antibody (H00010766-M01)

View related products by pathway.

PTMs for TOB2 Antibody (H00010766-M01)

Learn more about PTMs related to TOB2 Antibody (H00010766-M01).
 

Research Areas for TOB2 Antibody (H00010766-M01)

Find related products by research area.

Blogs on TOB2

There are no specific blogs for TOB2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TOB2 Antibody (2F2-1A7) and receive a gift card or discount.

Bioinformatics

Gene Symbol TOB2
Entrez
OMIM
Uniprot