TNP1 Antibody


Immunohistochemistry-Paraffin: TNP1 Antibody [NBP2-30567] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: TNP1 Antibody [NBP2-30567] - Staining of human fallopian tube shows low expression as expected.
Immunohistochemistry-Paraffin: TNP1 Antibody [NBP2-30567] - Staining in human testis and fallopian tube tissues using anti-TNP1 antibody. Corresponding TNP1 RNA-seq data are presented for the same tissues.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

TNP1 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: STSRKLKSHGMRRSKSRSPHKGVKRGGSKRKYRKGNLKSRKRGDDANRNYRSHL
Specificity of human TNP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TNP1 Protein (NBP2-30567PEP)
Read Publication using NBP2-30567.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (87%). Reactivity reported in scientific literature (PMID: 24598113)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for TNP1 Antibody

  • spermatid nuclear transition protein 1
  • STP-1
  • TP1
  • TP-1
  • transition protein 1 (during histone to protamine replacement)


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: Flow, ICC/IF, IHC, IP
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
Species: Hu
Applications: WB, ICC
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, PAGE, IF

Publications for TNP1 Antibody (NBP2-30567)(1)

Reviews for TNP1 Antibody (NBP2-30567) (0)

There are no reviews for TNP1 Antibody (NBP2-30567). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TNP1 Antibody (NBP2-30567) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional TNP1 Products

Bioinformatics Tool for TNP1 Antibody (NBP2-30567)

Discover related pathways, diseases and genes to TNP1 Antibody (NBP2-30567). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TNP1 Antibody (NBP2-30567)

Discover more about diseases related to TNP1 Antibody (NBP2-30567).

Pathways for TNP1 Antibody (NBP2-30567)

View related products by pathway.

PTMs for TNP1 Antibody (NBP2-30567)

Learn more about PTMs related to TNP1 Antibody (NBP2-30567).

Blogs on TNP1

There are no specific blogs for TNP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TNP1 Antibody and receive a gift card or discount.


Gene Symbol TNP1