Novus Biologicals products are now on

TNP1 Antibody


Orthogonal Strategies: Immunohistochemistry-Paraffin: TNP1 Antibody [NBP2-30567] - Staining in human testis and fallopian tube tissues using anti-TNP1 antibody. Corresponding TNP1 RNA-seq data are presented for more
Immunohistochemistry-Paraffin: TNP1 Antibody [NBP2-30567] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: TNP1 Antibody [NBP2-30567] - Staining of human fallopian tube shows low expression as expected.

Product Details

Reactivity HuSpecies Glossary
Applications IHC
Validated by:

Orthogonal Strategies


Order Details

TNP1 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: STSRKLKSHGMRRSKSRSPHKGVKRGGSKRKYRKGNLKSRKRGDDANRNYRSHL
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TNP1 Protein (NBP2-30567PEP)
Read Publication using NBP2-30567.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (87%). Reactivity reported in scientific literature (PMID: 24598113)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for TNP1 Antibody

  • spermatid nuclear transition protein 1
  • STP-1
  • TP1
  • TP-1
  • transition protein 1 (during histone to protamine replacement)


Transition protein-1 is a spermatid-specific product of the haploid genome which replaces histone and is itself replaced in the mature sperm by the protamines (see PRM1, MIM 182880; PRM2, MIM 182890) (Luerssen et al., 1990 [PubMed 2249851]).[supplied by OMIM]


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: ChIP, ChIP, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, KO, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IP, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Ca, Hu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P, IP, WB (-)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, MI, WB
Species: Hu
Applications: ChIP, ICC/IF, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB

Publications for TNP1 Antibody (NBP2-30567)(1)

Reviews for TNP1 Antibody (NBP2-30567) (0)

There are no reviews for TNP1 Antibody (NBP2-30567). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TNP1 Antibody (NBP2-30567) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TNP1 Antibody and receive a gift card or discount.


Gene Symbol TNP1