TNFSF12-TNFSF13 Antibody

Images

 
Western Blot: TWEAK Antibody [NBP1-86895] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: TNFSF12-TNFSF13 Antibody [NBP1-86895] - Staining of human tonsil shows distinct positivity in a subset of leukocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TNFSF12-TNFSF13 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LEAWENGERSRKRRAVLTQKQKKQHSVLHLVPINATSKDDSDVTEVMWQPALRRGRGLQAQGYGVRIQDAGVYLLYSQVLFQDVTFTMGQVVSREGQGRQETLFRCIRSMPSHPDRAYNSCYSAGVFHLHQGDILS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TNFSF12
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TNFSF12-TNFSF13 Recombinant Protein Antigen (NBP1-86895PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%), Rat (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TNFSF12-TNFSF13 Antibody

  • TNFSF12-TNFSF13 Readthrough
  • Tumor Necrosis Factor (Ligand) Superfamily, Member 12-Member 13
  • TWE-PRIL

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-97587
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-1199
Species: Hu, Mu, Rt, Po
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-97637
Species: Hu
Applications: WB, B/N, ELISA, Flow, ICC/IF, IHC
AF1162
Species: Hu
Applications: WB, Flow, CyTOF-ready, Neut
NB100-56516
Species: Hu, Mu
Applications: WB, IHC
NBP1-86895
Species: Hu
Applications: WB, IHC, IHC-P

Publications for TNFSF12-TNFSF13 Antibody (NBP1-86895) (0)

There are no publications for TNFSF12-TNFSF13 Antibody (NBP1-86895).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TNFSF12-TNFSF13 Antibody (NBP1-86895) (0)

There are no reviews for TNFSF12-TNFSF13 Antibody (NBP1-86895). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TNFSF12-TNFSF13 Antibody (NBP1-86895) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TNFSF12-TNFSF13 Products

Bioinformatics Tool for TNFSF12-TNFSF13 Antibody (NBP1-86895)

Discover related pathways, diseases and genes to TNFSF12-TNFSF13 Antibody (NBP1-86895). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on TNFSF12-TNFSF13

There are no specific blogs for TNFSF12-TNFSF13, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TNFSF12-TNFSF13 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TNFSF12
Entrez