TNFAIP8L2 Antibody - BSA Free

Western Blot: TNFAIP8L2 Antibody [NBP2-86869] - Host: Rabbit. Target Name: TNFAIP8L2. Sample Type: MCF7 Whole cell lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

TNFAIP8L2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TNFAIP8L2 Antibody - BSA Free (NBP2-86869) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human TNFAIP8L2. Peptide sequence: LQAEKKLLSKMAGRSVAHLFIDETSSEVLDELYRVSKEYTHSRPQAQRVI The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TNFAIP8L2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for TNFAIP8L2 Antibody - BSA Free

• FLJ23467
• Inflammation factor protein 20
• TIPE2
• TIPE2inflammation factor 20
• TNF alpha-induced protein 8-like protein 2
• TNFAIP8-like protein 2
• tumor necrosis factor alpha-induced protein 8-like protein 2
• tumor necrosis factor, alpha-induced protein 8-like 2
• tumor necrosis factor, alpha-induced protein 8-like protein 2

Background

TNFAIP8L2 acts as a negative regulator of innate and adaptive immunity by maintaining immune homeostasis. Negativeregulator of Toll-like receptor and T-cell receptor function. Prevents hyperresponsiveness of the immune system andmaintains immune homeostasis. Inhibi

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TNFAIP8L2