TNFAIP8L2 Antibody

Images

 
Western Blot: TNFAIP8L2 Antibody [H00079626-B01P] - Analysis of TNFAIP8L2 expression in transfected 293T cell line by TNFAIP8L2 polyclonal antibody. Lane 1: TNFAIP8L2 transfected lysate(20.24 KDa). Lane 2: ...read more

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TNFAIP8L2 Antibody Summary

Immunogen
TNFAIP8L2 (AAH63014, 1 a.a. - 184 a.a.) full-length human protein. MESFSSKSLALQAEKKLLSKMAGRSVAHLFIDETSSEVLDELYRVSKEYTHSRPQAQRVIKDLIKVAIKVAVLHRNGSFGPSELALATRFRQKLRQGAMTALSFGEVDFTFEAAVLAGLLTECRDVLLELVEHHLTPKSHGRIRHVFDHFSDPGLLTALYGPDFTQHLGKICDGLRKLLDEGKL
Specificity
Reacts with tumor necrosis factor, alpha-induced protein 8-like 2.
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
TNFAIP8L2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
This antibody is reactive against transfected lysate in western blot, and as a detection antibody in ELISA.
Publications
Read Publication using H00079626-B01P.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TNFAIP8L2 Antibody

  • FLJ23467
  • Inflammation factor protein 20
  • TIPE2
  • TIPE2inflammation factor 20
  • TNF alpha-induced protein 8-like protein 2
  • TNFAIP8-like protein 2
  • tumor necrosis factor alpha-induced protein 8-like protein 2
  • tumor necrosis factor, alpha-induced protein 8-like 2
  • tumor necrosis factor, alpha-induced protein 8-like protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-00317
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-39002
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, IB, ICC/IF, IHC, IHC-P, IP, Single-Cell Western
NBP1-84957
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
6507-IL/CF
Species: Hu
H00003669-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP2-50037
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, KO
NB100-56530
Species: Hu
Applications: WB
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24875
Species: Hu, Mu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, BA, B/N, Flow-IC
NBP2-46403
Species: Hu
Applications: IHC, IHC-P
NBP2-88937
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32905
Species: Hu, Bv, Pm, Rb
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO

Publications for TNFAIP8L2 Antibody (H00079626-B01P)(1)

Reviews for TNFAIP8L2 Antibody (H00079626-B01P) (0)

There are no reviews for TNFAIP8L2 Antibody (H00079626-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TNFAIP8L2 Antibody (H00079626-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TNFAIP8L2 Products

Bioinformatics Tool for TNFAIP8L2 Antibody (H00079626-B01P)

Discover related pathways, diseases and genes to TNFAIP8L2 Antibody (H00079626-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TNFAIP8L2 Antibody (H00079626-B01P)

Discover more about diseases related to TNFAIP8L2 Antibody (H00079626-B01P).
 

Pathways for TNFAIP8L2 Antibody (H00079626-B01P)

View related products by pathway.

PTMs for TNFAIP8L2 Antibody (H00079626-B01P)

Learn more about PTMs related to TNFAIP8L2 Antibody (H00079626-B01P).

Blogs on TNFAIP8L2

There are no specific blogs for TNFAIP8L2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TNFAIP8L2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TNFAIP8L2
Entrez
Uniprot