Home » TNFAIP8L2 » TNFAIP8L2 Antibodies » TNFAIP8L2 Antibody

TNFAIP8L2 Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: TNFAIP8L2 Antibody [H00079626-B01P] - Analysis of TNFAIP8L2 expression in transfected 293T cell line by TNFAIP8L2 polyclonal antibody. Lane 1: TNFAIP8L2 transfected lysate(20.24 KDa). Lane 2: Non-transfected lysate.
Western Blot: TNFAIP8L2 Antibody [H00079626-B01P] - Analysis of TNFAIP8L2 expression in transfected 293T cell line by TNFAIP8L2 polyclonal antibody. Lane 1: TNFAIP8L2 transfected lysate(20.24 KDa). Lane 2: ...read more

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

TNFAIP8L2 Antibody Summary

Immunogen
TNFAIP8L2 (AAH63014, 1 a.a. - 184 a.a.) full-length human protein. MESFSSKSLALQAEKKLLSKMAGRSVAHLFIDETSSEVLDELYRVSKEYTHSRPQAQRVIKDLIKVAIKVAVLHRNGSFGPSELALATRFRQKLRQGAMTALSFGEVDFTFEAAVLAGLLTECRDVLLELVEHHLTPKSHGRIRHVFDHFSDPGLLTALYGPDFTQHLGKICDGLRKLLDEGKL
Specificity
Reacts with tumor necrosis factor, alpha-induced protein 8-like 2.
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
TNFAIP8L2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
This antibody is reactive against transfected lysate in western blot, and as a detection antibody in ELISA.
Publications
Read Publication using H00079626-B01P.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TNFAIP8L2 Antibody

  • FLJ23467
  • Inflammation factor protein 20
  • TIPE2
  • TIPE2inflammation factor 20
  • TNF alpha-induced protein 8-like protein 2
  • TNFAIP8-like protein 2
  • tumor necrosis factor alpha-induced protein 8-like protein 2
  • tumor necrosis factor, alpha-induced protein 8-like 2
  • tumor necrosis factor, alpha-induced protein 8-like protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

TNFAIP8 Antibody
NBP3-00317
Western Blot: TNFAIP8 Antibody [NBP3-00317] - Anti-TNFAIP8 rabbit polyclonal antibody at 1:500 dilution. Lane A: K562 Whole Cell Lysate. Lysates/proteins at 30 ug per lane. Secondary Goat Anti-Rabbit IgG H&L (Dylight 800) at 1/10000 dilution. Developed using the Odyssey technique. Performed under reducing conditions. Predicted band size: 23 kDa. Observed band size: 33 kDa
Immunohistochemistry-Paraffin: TNFAIP8 Antibody [NBP3-00317] - Immunochemical staining of human TNFAIP8 in human spleen with rabbit polyclonal antibody (1:10000, formalin-fixed paraffin embedded sections).
Immunohistochemistry-Paraffin: TNFAIP8 Antibody [NBP3-00317] - Immunochemical staining of human TNFAIP8 in human lung cancer with rabbit polyclonal antibody (1:10000, formalin-fixed paraffin embedded sections).
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
AKT [p Ser473]
Antibody - Pan Specif
AF887
Western blot shows lysates of NIH‑3T3 mouse embryonic fibroblast cell line untreated (-) or treated (+) with 100 ng/mL Human PDGF (Catalog # 120‑HD) for 15 minutes and MCF‑7 human breast cancer cell line untreated or treated with 100 ng/mL Recombinant Human IGF-1 (Catalog # 291‑G1) for 15 minutes. PVDF membrane was probed with 0.5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Akt (S473) Pan Specific at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of MCF‑7 human breast cancer cell line and A549 human lung carcinoma cell line untreated (-) or treated (+) with 100 ng/mL Recombinant Human IGF‑I (Catalog # 291-G1) for 15 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Akt (S473) at approximately 60 kDa (as indicated) using 5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Serum-starved MCF‑7 human breast cancer cells were unstimulated (light orange filled histogram) or activated with 100 ng/mL Recombinant human IGF-1 (Catalog # 291-G1, dark orange filled histogram) for 15 minutes, then stained with Rabbit Anti-Human/Mouse/Rat Phospho‑Akt (S473) Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF887) or control antibody (Catalog # AB-105-C, open histogram), followed by Allophycocyanin-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # F0111). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
(23 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
c-jun Antibody
(5B1)
NBP2-37576
Western Blot: c-jun Antibody (5B1) [NBP2-37576] - Analysis using c-Jun mouse mAb against NIH/3T3 (1) and Cos7 (2) cell lysate.
Immunocytochemistry/Immunofluorescence: c-jun Antibody (5B1) [NBP2-37576] - Analysis of PC-2 cells using c-Jun mouse mAb (green). Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: c-jun Antibody (5B1) [NBP2-37576] - Analysis of human rectum cancer tissues using c-Jun mouse mAb with DAB staining.
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(32 Reviews)
(645 Publications)
Species: Hu
FoxP3 Antibody
NB100-39002
Immunohistochemistry-Paraffin: FoxP3 Antibody [NB100-39002] - Mouse spleen stained with FoxP3 antibody. IHC-P image submitted by a verified customer review.
Immunohistochemistry-Paraffin: FoxP3 Antibody [NB100-39002] - Tissue section of human tonsil using 1:200 dilution of rabbit anti-FoxP3 antibody. The staining was developed with HRP-labeled anti-rabbit IgG secondary antibody and DAB reagent, and nuclei of cells were counter-stained with hematoxylin. This FoxP3 antibody generated an expected and a specific nuclear staining of FOXP3 in a subset of cells which are potentially the Treg cells.
Immunohistochemistry: FoxP3 Antibody [NB100-39002] - Antibody was tested in mouse spleen using DAB with hematoxylin counterstain.
(2 Reviews)
(22 Publications)
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, IB, ICC/IF, IHC, IHC-P, IP, Single-Cell Western
SLC10A3 Antibody
NBP1-84957
Western Blot: SLC10A3 Antibody [NBP1-84957] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-529
Immunohistochemistry-Paraffin: SLC10A3 Antibody [NBP1-84957] - Staining of human urinary bladder shows strong cytoplasmic positivity in urothelial cells.
(1 Publication)
Species: Hu
Applications: WB, IHC, IHC-P
CD25/IL-2R alpha
[HRP]
DR2A00
(31 Publications)
Species: Hu
Recombinant Human
ATP5G3 GST (N-Term) P ...
H00000518-P01
SDS-Page: Recombinant Human ATP5G3 Protein [H00000518-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
IL-2 [Unconjugated]
202-IL
1 μg/lane of Recombinant Human IL-2 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 13 kDa.
Recombinant Human IL-2 (Catalog # 202-IL) stimulates cell proliferation of the CTLL‑2 mouse cytotoxic T cell line. The ED50 for this effect is 0.05-0.25 ng/mL.
(22 Reviews)
(302 Publications)
Species: Hu
CD4 Antibody
NBP1-19371
Western Blot: CD4 Antibody [NBP1-19371] - CD4 antibody was tested in the following cell lysates: 1) human spleen 2) human tonsil 3) human placenta 4) human kidney 5) human liver 6) mouse spleen 7) mouse placenta 8) rat placenta.
Immunocytochemistry/Immunofluorescence: CD4 Antibody [NBP1-19371] - CD4 antibody was tested in Jurkat cells with DyLight 488 (green). Nuclei were counterstained with DAPI (blue).
Immunohistochemistry-Paraffin: CD4 Antibody [NBP1-19371] - Alcohol-fixed paraffin-embedded rat spleen tissue. Dilution 1:150. Image from verified customer review.
(8 Reviews)
(29 Publications)
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
IL-4 [Unconjugated]
6507-IL/CF
IL-4 [Unconjugated]
(3 Publications)
Species: Hu
ISG20 Antibody
(1B2-3C9)
H00003669-M01
Western Blot: ISG20 Antibody (1B2-3C9) [H00003669-M01] - Analysis of ISG20 expression in transfected 293T cell line by ISG20 monoclonal antibody (M01), clone 1B2-3C9.Lane 1: ISG20 transfected lysate(20.4 KDa).Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: ISG20 Antibody (1B2-3C9) [H00003669-M01] - Analysis of monoclonal antibody to ISG20 on HeLa cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: ISG20 Antibody (1B2-3C9) [H00003669-M01] - Detection limit for recombinant GST tagged ISG20 is approximately 0.1ng/ml as a capture antibody.
(2 Publications)
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
c-Fos Antibody
(2H2)
NBP2-50037
Knockout Validated: c-Fos Antibody (2H2) [NBP2-50037] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and c-Fox knockout (KO) HeLa cell line. PVDF membrane was probed with 1:1000 of Mouse Anti-Human c-Fox Monoclonal Antibody (Catalog # NBP2-50037) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog #HAF018). Specific band was detected for c-Fox at approximately 52 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Western Blot: c-Fos Antibody (2H2) [NBP2-50037] - Analysis of cell lysates using mouse c-Fos mAb, dilution 1:1,000 (Green), and rabbit GAPDH pAb, dilution 1:20,000 (Red) used as a loading control. [1] protein standard (red), [2] HeLa cells in serum free media. [3] HeLa cells stimulated with 20% fetal bovine serum for 2hrs after 36hrs in serum free media. [4] rat cortical neurons. [5] rat cortical neurons treated with membrane depolarization buffer for 5hrs. Multiple bands at 50-65kDa in stimulated or treated cell lysates correspond to different forms of the c-Fos proten. The single band at 37 kDa represents GAPDH protein.
Immunocytochemistry/Immunofluorescence: c-Fos Antibody (2H2) [NBP2-50037] - Section of rat hippocampus stained with mouse monoclonal antibody to c-FOS NBP2-50037 in red and counterstained with rabbit polyclonal antibody to FOX3/NeuN. DAPI reveals nuclei of neurons and glia in blue. The hippocampal neurons stain green for FOX3/NeuN and a few also are expressing c-FOS, and so appear orange. These cells were spontaneously active at the time the animal was sacrificed.
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, KO
FosB/G0S3 Antibody
(83B1138)
NB100-56530
Western Blot: FosB/G0S3 Antibody (83B1138) [NB100-56530] - Analysis of FosB in HeLa cell lysate where bands are observed at ~38 kDa representing FosB and at ~35 kDa representing delta FosB.
Species: Hu
Applications: WB
Sialin/SLC17A5
Antibody
NBP2-20383
Western Blot: SLC17A5 Antibody [NBP2-20383] - Sample (30 ug of whole cell lysate) A: Jurkat 10% SDS PAGE gel, diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: SLC17A5 Antibody [NBP2-20383] - Sample: HepG2 cells were fixed in -20C 100% MeOH for 5 min. Green: SLC17A5 protein stained by SLC17A5 antibody diluted at 1:500. Blue: Hoechst 33343 staining.
Immunohistochemistry-Paraffin: Sialin/SLC17A5 Antibody [NBP2-20383] - Mouse lung diluted at 1:500. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
TLR3 Antibody
(40C1285.6)
NBP2-24875
Flow Cytometry: TLR3 Antibody (40C1285.6) [NBP2-24875] - Expression of TLR3 protein on epithelial cells. HNEC (A), Detroit-562 (B) and FaDu (C) were stained intracellularly with FITC-Abs against TLR3 (open histograms) or appropriate isotype control (shaded histograms) and analyzed by flow cytometry. Representative pictures from one out of three independent experiments are shown. Image collected and cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pone.0098239), licensed under a CC-BY licence.
Western Blot: TLR3 Antibody (40C1285.6) [NBP2-24875] - All the cell lines displayed a strong expression of TLR3 protein. Cell lysates were electrophoresed and blotted to PVDF membrane, which was probed with TLR3-specific antibody. To confirm the immunoreactivity of the antibody, different positive controls were included. Beta-actin was served as loading control and was used to normalize expression levels between cells. Data are representative for analysis of >=2 independent experiments. Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.pone.0060671) licensed under a CC-BY licence.
Flow Cytometry: TLR3 Antibody (40C1285.6) [NBP2-24875] - Expression of TLR3 in Fravel, L363, OPM1, RPMI8226, XG1, and NCI-H929 as determined by flow cytometry. HCMLs were stained using an intracellular staining protocol with TLR3 antibodies followed by relevant secondary fluorescent-conjugated antibodies. Filled histograms (purple) represent the isotype controls and the open histograms (red) indicate TLR3. Data are representative for analysis of >=2 independent experiments. Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.pone.0060671) licensed under a CC-BY licence.
(76 Publications)
Species: Hu, Mu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, BA, B/N, Flow-IC
PIK3CA Antibody
(OTI6D9)
NBP2-46403
Immunohistochemistry: PIK3CA Antibody (6D9) [NBP2-46403] - Analysis of Human tonsil tissue. (Heat-induced epitope retrieval by 1 mM EDTA in 10mM Tris, pH8.5, 120C for 3min)
Immunohistochemistry: PIK3CA Antibody (6D9) [NBP2-46403] - Analysis of Adenocarcinoma of Human breast tissue. (Heat-induced epitope retrieval by 1 mM EDTA in 10mM Tris, pH8.5, 120C for 3min)
Immunohistochemistry: PIK3CA Antibody (6D9) [NBP2-46403] - Analysis of Adenocarcinoma of Human colon tissue. (Heat-induced epitope retrieval by 1 mM EDTA in 10mM Tris, pH8.5, 120C for 3min)
Species: Hu
Applications: IHC, IHC-P
PI 3-Kinase p110
beta/PIK3CB Antibody ...
NBP2-88937
Western Blot: PI 3-Kinase p110 beta/PIK3CB Antibody (CL9518) [NBP2-88937] - Analysis in human cell line HEL.
Immunocytochemistry/Immunofluorescence: PI 3-Kinase p110 beta/PIK3CB Antibody (CL9518) [NBP2-88937] - Staining of A-431 cells using the Anti-PIK3CB monoclonal antibody, showing specific staining in the nucleoplasm and cytosol in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available).
Immunohistochemistry-Paraffin: PI 3-Kinase p110 beta/PIK3CB Antibody (CL9518) [NBP2-88937] - Staining of human thyroid gland shows strong nuclear positivity in glandular cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MxA/Mx1 Antibody
NBP1-32905
Western Blot: MxA/Mx1 Antibody [NBP1-32905] - Various whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with MX1 antibody diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: MxA/Mx1 Antibody [NBP1-32905] - Detects MX1 protein at cytoplasm by immunofluorescent analysis. Sample: HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: MX1 protein stained by MX1 antibody, Internal diluted at 1:200. Red: alpha Tubulin, a cytoskeleton marker, stained by alpha Tubulin antibody diluted at 1:1000. Blue: Hoechst 33342 staining.
Immunohistochemistry-Paraffin: MxA/Mx1 Antibody [NBP1-32905] - Human lymph node. Antigen retrieval in citrate buffer, 95C for 30 min. Image from verified customer review.
(1 Review)
Species: Hu, Bv, Pm, Rb
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
PI 3-Kinase p110
gamma Antibody
NBP2-15071
Western Blot: PI 3-Kinase p110 gamma Antibody [NBP2-15071] - Non-transfected (-) and transfected (+) 293T whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with PI3 kinase p110 gamma antibody [C3], C-term diluted at 1:500. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunohistochemistry-Paraffin: PI 3-Kinase p110 gamma Antibody [NBP2-15071] - Human Breast Cancer, using PI3K gamma antibody. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min
Western Blot: PI 3-Kinase p110 gamma Antibody [NBP2-15071] - Whole cell extract (30ug) was separated by 7.5% SDS-PAGE, and the membrane was blotted with PI3 kinase p110 gamma antibody [C3], C-term diluted at 1:1000.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO

Publications for TNFAIP8L2 Antibody (H00079626-B01P)(1)


Reviews for TNFAIP8L2 Antibody (H00079626-B01P) (0)

There are no reviews for TNFAIP8L2 Antibody (H00079626-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TNFAIP8L2 Antibody (H00079626-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional TNFAIP8L2 Products

Bioinformatics Tool for TNFAIP8L2 Antibody (H00079626-B01P)

Discover related pathways, diseases and genes to TNFAIP8L2 Antibody (H00079626-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TNFAIP8L2 Antibody (H00079626-B01P)

Discover more about diseases related to TNFAIP8L2 Antibody (H00079626-B01P).
 

Pathways for TNFAIP8L2 Antibody (H00079626-B01P)

View related products by pathway.

PTMs for TNFAIP8L2 Antibody (H00079626-B01P)

Learn more about PTMs related to TNFAIP8L2 Antibody (H00079626-B01P).

Blogs on TNFAIP8L2

There are no specific blogs for TNFAIP8L2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TNFAIP8L2 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol TNFAIP8L2
Entrez
Uniprot