TNFAIP8L2 Antibody - Azide and BSA Free

Western Blot: TNFAIP8L2 Antibody [H00079626-B01P] - Analysis of TNFAIP8L2 expression in transfected 293T cell line by TNFAIP8L2 polyclonal antibody. Lane 1: TNFAIP8L2 transfected lysate(20.24 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu, Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

TNFAIP8L2 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse TNFAIP8L2 Antibody - Azide and BSA Free (H00079626-B01P) is a polyclonal antibody validated for use in WB. Anti-TNFAIP8L2 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: TNFAIP8L2 (AAH63014, 1 a.a. - 184 a.a.) full-length human protein. MESFSSKSLALQAEKKLLSKMAGRSVAHLFIDETSSEVLDELYRVSKEYTHSRPQAQRVIKDLIKVAIKVAVLHRNGSFGPSELALATRFRQKLRQGAMTALSFGEVDFTFEAAVLAGLLTECRDVLLELVEHHLTPKSHGRIRHVFDHFSDPGLLTALYGPDFTQHLGKICDGLRKLLDEGKL
• Specificity: Reacts with tumor necrosis factor, alpha-induced protein 8-like 2.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: TNFAIP8L2
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: This antibody is reactive against transfected lysate in western blot, and as a detection antibody in ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TNFAIP8L2 Antibody - Azide and BSA Free

• FLJ23467
• Inflammation factor protein 20
• TIPE2
• TIPE2inflammation factor 20
• TNF alpha-induced protein 8-like protein 2
• TNFAIP8-like protein 2
• tumor necrosis factor alpha-induced protein 8-like protein 2
• tumor necrosis factor, alpha-induced protein 8-like 2
• tumor necrosis factor, alpha-induced protein 8-like protein 2

Background

TNFAIP8L2 acts as a negative regulator of innate and adaptive immunity by maintaining immune homeostasis. Negativeregulator of Toll-like receptor and T-cell receptor function. Prevents hyperresponsiveness of the immune system andmaintains immune homeostasis. Inhibi

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TNFAIP8L2 Antibody (H00079626-B01P)(1)

Publication using H00079626-B01P

• Sui HX, Ke SZ, Xu DD et al. Nicotine induces TIPE2 upregulation and Stat3 phosphorylation contributes to cholinergic anti-inflammatory effect. Int J Oncol 2017-07-27 [PMID: 28766689]

Bioinformatics

• Gene Symbol: TNFAIP8L2
• Entrez:
  • 79626(Human)
• Uniprot:
  • AAH63014(Human)