TMX2 Antibody


Western Blot: TMX2 Antibody [NBP1-69586] - This Anti-TXNDC14 antibody was used in Western Blot of Fetal Liver tissue lysate at a concentration of 1ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

TMX2 Antibody Summary

Synthetic peptides corresponding to TXNDC14(thioredoxin domain containing 14) The peptide sequence was selected from the middle region of TXNDC14. Peptide sequence IRMGLLYITLCIVFLMTCKPPLYMGPEYIKYFNDKTIDEELERDKRVTWI.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against TXNDC14 and was validated on Western blot.
Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TMX2 Antibody

  • Cell proliferation-inducing gene 26 protein
  • DKFZp781O2021
  • growth-inhibiting gene 11
  • MGC111151
  • PDIA12
  • PIG26
  • protein disulfide isomerase family A, member 12
  • thioredoxin domain containing 14
  • Thioredoxin domain-containing protein 14
  • thioredoxin-related transmembrane protein 2
  • TXNDC14


The exact function of TXNDC14 remains unknown.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Ca, Mk
Applications: WB, IHC, IF
Species: Hu
Applications: WB, IHC, IHC-P, KD
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Dr, GP, Rb, Sh, Xp, Ze
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Mk, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB

Publications for TMX2 Antibody (NBP1-69586) (0)

There are no publications for TMX2 Antibody (NBP1-69586).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TMX2 Antibody (NBP1-69586) (0)

There are no reviews for TMX2 Antibody (NBP1-69586). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TMX2 Antibody (NBP1-69586) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional TMX2 Products

Bioinformatics Tool for TMX2 Antibody (NBP1-69586)

Discover related pathways, diseases and genes to TMX2 Antibody (NBP1-69586). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TMX2 Antibody (NBP1-69586)

Discover more about diseases related to TMX2 Antibody (NBP1-69586).

Pathways for TMX2 Antibody (NBP1-69586)

View related products by pathway.

PTMs for TMX2 Antibody (NBP1-69586)

Learn more about PTMs related to TMX2 Antibody (NBP1-69586).

Blogs on TMX2

There are no specific blogs for TMX2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TMX2 Antibody and receive a gift card or discount.


Gene Symbol TMX2