TMPRSS11E Antibody - BSA Free

Immunohistochemistry: TMPRSS11E Antibody [NBP2-48995] - Staining of human esophagus shows moderate membranous positivity in superficial layer of squamous epithelial cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TMPRSS11E Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: VLAHMLLICRFHSTEDPETVDKIVQLVLHEKLQDAVGPPKVDPHSVKIKKINKTETDSYLNHCCGTRRSKTLGQSLRIVGGTEVEEGEWP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TMPRSS11E
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  TMPRSS11E Recombinant Protein Antigen (NBP2-48995PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TMPRSS11E Antibody - BSA Free

• DESC1
• FLJ75331
• FLJ94490
• MGC141972
• MGC141974
• serine 11E2
• serine protease DESC1
• TMPRSS11E2
• transmembrane protease serine 11E
• transmembrane protease serine 11E2
• transmembrane protease, serine 11E
• UNQ742/PRO1461

Background

TMPRSS11E is a member of a larger family of membrane attached serine proteases, a poorly defined group that includes TMPRSS11A, B, C, D, E, F, Hepsin, Corin, Matriptase 1, 2 and 3. The highest degree of identity is with TMPRSS11A, which shares 43% identity at the amino acid level. TMPRSS11E has a domain structure of an aminoterminal cytoplasmic domain, followed by a transmembrane domain, a SEA domain (Sea urchin sperm protein, Enterokinase, Agrin), a short spacer, then the trypsin like serine protease domain. The SEA domain is thought to play a role in carbohydrate binding in the analogous protein sequences where it is found, but the role in TMPRSS11E is unclear. The cleavage of the Arg191 Ile192 bond liberates the catalytic domain. TMPRSS11E has been shown to cleave fibronectin, gelatin, casein and pro uPA in vitro, and to form complexes with serpinA5 and serpinE1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TMPRSS11E