Recombinant Human TMLHE Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human TMLHE Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-376 of Human TMLHE full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MWYHRLSHLHSRLQDLLKGGVIYPALPQPNFKSLLPLAVHWHHTASKSLTCAWQQHEDHFELKYANTVMRFDYVWLRDHCRSASCYNSKTHQRSLDTASVDLCIKPKTIRLDETTLFFTWPDGHVTKYDLNWLVKNSYEGQKQKVIQPRILWNAEIYQQAQVPSVDCQSFLETNEGLKKFLQNFLLYGIAFVENVPPTQEHTEKLAERISLIRETIYGRMWYFTSDFSRGDTAYTKLALDRHTDTTYFQEPCGIQVFHCLKHEGTGGRTLLVDGFYAAEQVLQKAPEEFELLSKVPLKHEYIEDVGECHNHMIGIGPVLNIYPWNKELYLIRLFKEKQNTVNRQWNSSLQCDIPERILTYRHFVSGTSIEHRGSLI

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
TMLHE
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TMLHE Protein

  • BBOX2TML-alpha-ketoglutarate dioxygenase
  • butyrobetaine (gamma), 2-oxoglutarate dioxygenase (gamma-butyrobetainehydroxylase) 2
  • EC 1.14.11.8
  • Epsilon-trimethyllysine 2-oxoglutarate dioxygenase
  • Epsilon-trimethyllysine hydroxylase
  • FLJ10727
  • TML dioxygenase
  • TMLD
  • TMLHTML hydroxylase
  • trimethyllysine dioxygenase, mitochondrial
  • trimethyllysine hydroxylase, epsilon
  • XAP130

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45548
Species: Hu
Applications: WB, IHC, IF
NBP2-57222
Species: Hu
Applications: ICC/IF
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
MAB7127
Species: Hu
Applications: WB
AF2485
Species: Hu
Applications: WB, IHC, IP
NBP1-59576
Species: Hu
Applications: WB, IHC
NBP2-03754
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4377
Species: Hu, Mu
Applications: WB, ICC
NB600-501
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Fi, GP, Ha, Le, Ma, Pm, Rb, Sh, Sq, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00006583-A01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-FrFl, IHC-WhMt
NBP1-89417
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-59941
Species: Hu
Applications: WB, IHC
NBP1-85819
Species: Hu
Applications: WB, IHC, IHC-P, IF
NB100-78039
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-CS
NBP1-87383
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81193
Species: Hu
Applications: Simple Western, ICC/IF, IHC, IHC-P
H00004354-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP1-89296
Species: Hu
Applications: WB, IHC, IHC-P

Publications for TMLHE Recombinant Protein (H00055217-P01) (0)

There are no publications for TMLHE Recombinant Protein (H00055217-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TMLHE Recombinant Protein (H00055217-P01) (0)

There are no reviews for TMLHE Recombinant Protein (H00055217-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TMLHE Recombinant Protein (H00055217-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TMLHE Products

Bioinformatics Tool for TMLHE Recombinant Protein (H00055217-P01)

Discover related pathways, diseases and genes to TMLHE Recombinant Protein (H00055217-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TMLHE Recombinant Protein (H00055217-P01)

Discover more about diseases related to TMLHE Recombinant Protein (H00055217-P01).
 

Pathways for TMLHE Recombinant Protein (H00055217-P01)

View related products by pathway.

Research Areas for TMLHE Recombinant Protein (H00055217-P01)

Find related products by research area.

Blogs on TMLHE

There are no specific blogs for TMLHE, but you can read our latest blog posts.

Customers Who Bought This Also Bought

TMLHE Antibody
NBP1-88693

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TMLHE Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TMLHE