SLC38A10 Antibody - BSA Free

Immunohistochemistry-Paraffin: SLC38A10 Antibody [NBP1-81193] - Staining in human gallbladder and skeletal muscle tissues using anti-SLC38A10 antibody. Corresponding SLC38A10 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: SLC38A10 Antibody [NBP1-81193] - Staining of human gallbladder, kidney, skeletal muscle and testis using Anti-SLC38A10 antibody NBP1-81193 (A) shows similar protein distribution across tissues to independent antibody NBP1-81194 (B).

Immunocytochemistry/Immunofluorescence: SLC38A10 Antibody [NBP1-81193] - Staining of human cell line U-2 OS shows localization to the Golgi apparatus. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: SLC38A10 Antibody [NBP1-81193] - Staining of human testis.

Immunohistochemistry-Paraffin: SLC38A10 Antibody [NBP1-81193] - Staining of human gallbladder shows high expression.

Immunohistochemistry-Paraffin: SLC38A10 Antibody [NBP1-81193] - Staining of human skeletal muscle shows low expression as expected.

Immunohistochemistry-Paraffin: SLC38A10 Antibody [NBP1-81193] - Staining of human kidney.

Simple Western: SLC38A10 Antibody [NBP1-81193] - Simple Western lane view shows a specific band for SLC38A10 in 0.2 mg/ml of RT-4 (left) and U-2OS (right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.

Simple Western: SLC38A10 Antibody [NBP1-81193] - Electropherogram image(s) of corresponding Simple Western lane view. SLC38A10 antibody was used at 1:40 dilution on RT-4 and U-2OS lysates(s).

• Reactivity: Hu
• Applications: Simple Western, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SLC38A10 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PEDLAGEAPGGRLGEAEGLMKVEAARLSAQDPVVAVAEDGREKPKLPKEREELEQAQIKGPVDVPGREDGKEAPEEAQLDRPGQGIAVPV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC38A10
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Simple Western 1:40
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
  
  In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
  See Simple Western Antibody Database for Simple Western validation: Tested in RT-4 and U-2OS, separated by Size, antibody dilution of 1:40, apparent MW was 169 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.
• Control Peptide:

  SLC38A10 Protein (NBP1-81193PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SLC38A10 Antibody - BSA Free

• FLJ35718
• FLJ46399
• MGC15523
• PP1744
• putative sodium-coupled neutral amino acid transporter 10
• solute carrier family 38, member 10

Background

Putative sodium-dependent amino acid/proton antiporter

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC38A10
• Entrez:
  • 124565(Human)