TMIE Antibody

Images

 
Immunohistochemistry-Paraffin: TMIE Antibody [NBP1-84260] - Staining of human hippocampus shows strong cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TMIE Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RTRKEIEARYLQRKAAKMYTDKLETVPPLNELTEVPGEDKKKKK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TMIE
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TMIE Protein (NBP1-84260PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TMIE Antibody

  • deafness, autosomal recessive 6
  • DFNB6
  • transmembrane inner ear expressed protein
  • transmembrane inner ear protein
  • transmembrane inner ear

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-60106
Species: Hu
Applications: WB, IHC, IHC-P
H00064699-M01
Species: Hu
Applications: WB, ELISA
NB100-2728
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP1-85704
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NLS1729
Species: Hu, Eq
Applications: WB, IHC-P
NBP1-59791
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84266
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-46574
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-79280
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-56991
Species: Hu
Applications: WB
NBP1-92172
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P

Publications for TMIE Antibody (NBP1-84260) (0)

There are no publications for TMIE Antibody (NBP1-84260).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TMIE Antibody (NBP1-84260) (0)

There are no reviews for TMIE Antibody (NBP1-84260). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TMIE Antibody (NBP1-84260) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TMIE Products

Bioinformatics Tool for TMIE Antibody (NBP1-84260)

Discover related pathways, diseases and genes to TMIE Antibody (NBP1-84260). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TMIE Antibody (NBP1-84260)

Discover more about diseases related to TMIE Antibody (NBP1-84260).
 

Pathways for TMIE Antibody (NBP1-84260)

View related products by pathway.

Blogs on TMIE

There are no specific blogs for TMIE, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TMIE Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TMIE