TMEM66 Antibody

Images

 
Western Blot: TMEM66 Antibody [NBP1-69489] - This Anti-TMEM66 antibody was used in Western Blot of Transfected 293T tissue lysate at a concentration of 1ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TMEM66 Antibody Summary

Immunogen
Synthetic peptides corresponding to TMEM66(transmembrane protein 66) The peptide sequence was selected from the middle region of TMEM66. Peptide sequence TNSAGPPPPGFKSEFTGPQNTGHGATSGFGSAFTGQQGYENSGPGFWTGL.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TMEM66
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against TMEM66 and was validated on Western blot.
Theoretical MW
37 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TMEM66 Antibody

  • FLJ22274
  • FOAP-7
  • HBV XAg-transactivated protein 3
  • HBV X-transactivated gene 3 protein
  • MGC8721
  • Protein FOAP-7
  • transmembrane protein 66
  • XTP3

Background

TMEM66 is a multi-pass membrane protein. It belongs to the TMEM66 family. The exact function of TMEM66 remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006786-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP1-76791
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-70452
Species: Hu
Applications: WB
NBP2-19784
Species: Hu, Mu, Rt, Ye
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP1-87256
Species: Hu
Applications: IHC, IHC-P
NBP1-84988
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59476
Species: Hu
Applications: WB
AF4004
Species: Hu, Mu, Rt
Applications: WB, IHC
NB100-56076
Species: Hu, Mu, Rt, Ge
Applications: WB, IHC, IHC-P, IP
NBP1-85373
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-41169
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC
NBP1-81804
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP1-19015
Species: Hu, Mu
Applications: WB, Simple Western, ELISA, ICC/IF, IP
NBP1-07100
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-81210
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-22617
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-34060
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-69489
Species: Hu
Applications: WB

Publications for TMEM66 Antibody (NBP1-69489) (0)

There are no publications for TMEM66 Antibody (NBP1-69489).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TMEM66 Antibody (NBP1-69489) (0)

There are no reviews for TMEM66 Antibody (NBP1-69489). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TMEM66 Antibody (NBP1-69489) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TMEM66 Products

Bioinformatics Tool for TMEM66 Antibody (NBP1-69489)

Discover related pathways, diseases and genes to TMEM66 Antibody (NBP1-69489). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TMEM66 Antibody (NBP1-69489)

Discover more about diseases related to TMEM66 Antibody (NBP1-69489).
 

Pathways for TMEM66 Antibody (NBP1-69489)

View related products by pathway.

Blogs on TMEM66

There are no specific blogs for TMEM66, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TMEM66 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TMEM66
Uniprot