![Western Blot: YTHDF3 Antibody [NBP2-94636] - Western blot analysis of extracts of HepG2 cells, using YTHDF3 antibody (NBP2-94636) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.](http://images.novusbio.com/fullsize/YTHDF3-Antibody-Western-Blot-NBP2-94636-img0004.jpg "Western Blot: YTHDF3 Antibody [NBP2-94636] - Western blot analysis of extracts of HepG2 cells, using YTHDF3 antibody (NBP2-94636) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC, IP |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-275 of human YTHDF3 (NP_689971.4). MSATSVDQRPKGQGNKVSVQNGSIHQKDAVNDDDFEPYLSSQTNQSNSYPPMSDPYMPSYYAPSIGFPYSLGEAAWSTAGDQPMPYLTTYGQMSNGEHHYIPDGVFSQPGALGNTPPFLGQHGFNFFPGNADFSTWGTSGSQGQSTQSSAYSSSYGYPPSSLGRAITDGQAGFGNDTLSKVPGISSIEQGMTGLKIGGDLTAAVTKTVGTALSSSGMTSIATNSVPPVSSAAPKPTSWAAIARKPAKPQPKLKPKGNVGIGGSAVPPPPIKHNMN |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | YTHDF3 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Theoretical MW | 63 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
| Publications |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for YTHDF3 Antibody (NBP2-94636)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | YTHDF3 |
![Immunohistochemistry-Paraffin: YTHDF3 Antibody [NBP2-94636] - Immunohistochemistry of paraffin-embedded rat brain using YTHDF3 Rabbit pAb (NBP2-94636) at dilution of 1:500 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/YTHDF3-Antibody-Immunohistochemistry-Paraffin-NBP2-94636-img0003.jpg "Immunohistochemistry-Paraffin: YTHDF3 Antibody [NBP2-94636] - Immunohistochemistry of paraffin-embedded rat brain using YTHDF3 Rabbit pAb (NBP2-94636) at dilution of 1:500 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.")
![Western Blot: YTHDF3 Antibody [NBP2-94636] - Western blot analysis of extracts of Mouse liver, using YTHDF3 antibody (NBP2-94636) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.](http://images.novusbio.com/fullsize/YTHDF3 Antibody-Western Blot-NBP2-94636-img0005.jpg "Western Blot: YTHDF3 Antibody [NBP2-94636] - Western blot analysis of extracts of Mouse liver, using YTHDF3 antibody (NBP2-94636) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.")
![Immunohistochemistry-Paraffin: YTHDF3 Antibody [NBP2-94636] - Immunohistochemistry of paraffin-embedded mouse brain using YTHDF3 Rabbit pAb (NBP2-94636) at dilution of 1:500 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/YTHDF3-Antibody-Immunohistochemistry-Paraffin-NBP2-94636-img0002.jpg "Immunohistochemistry-Paraffin: YTHDF3 Antibody [NBP2-94636] - Immunohistochemistry of paraffin-embedded mouse brain using YTHDF3 Rabbit pAb (NBP2-94636) at dilution of 1:500 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.")
![Immunoprecipitation: YTHDF3 Antibody [NBP2-94636] - Immunoprecipitation analysis of 300ug extracts of HT-1080 cells using 3ug YTHDF3 antibody (NBP2-94636). Western blot was performed from the immunoprecipitate using YTHDF3 antibody (NBP2-94636) at a dilution of 1:1000.](http://images.novusbio.com/fullsize/YTHDF3-Antibody-Immunoprecipitation-NBP2-94636-img0001.jpg "Immunoprecipitation: YTHDF3 Antibody [NBP2-94636] - Immunoprecipitation analysis of 300ug extracts of HT-1080 cells using 3ug YTHDF3 antibody (NBP2-94636). Western blot was performed from the immunoprecipitate using YTHDF3 antibody (NBP2-94636) at a dilution of 1:1000.")
![Immunocytochemistry/ Immunofluorescence: YTHDF3 Antibody - BSA Free [YTHDF3] - Immunofluorescence analysis of HeLa cells using YTHDF3 Rabbit pAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp2-94636_rabbit-polyclonal-ythdf3-antibody-5220251636335.jpg "Immunocytochemistry/ Immunofluorescence: YTHDF3 Antibody - BSA Free [YTHDF3] - Immunofluorescence analysis of HeLa cells using YTHDF3 Rabbit pAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.")
![Immunocytochemistry/ Immunofluorescence: YTHDF3 Antibody - BSA Free [YTHDF3] - Immunofluorescence analysis of NIH/3T3 cells using YTHDF3 Rabbit pAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp2-94636_rabbit-polyclonal-ythdf3-antibody-5220251638027.jpg "Immunocytochemistry/ Immunofluorescence: YTHDF3 Antibody - BSA Free [YTHDF3] - Immunofluorescence analysis of NIH/3T3 cells using YTHDF3 Rabbit pAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.")
![N/A IL-12/IL-23 p40 [Biotin]](https://images.novusbio.com/images2/DATA_IL12_p40_DY499_ELISA_2069.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")