TMEM184A Antibody

Images

 
Western Blot: TMEM184A Antibody [NBP1-70728] - Human Placenta lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TMEM184A Antibody Summary

Immunogen
Synthetic peptides corresponding to TMEM184A(transmembrane protein 184A) The peptide sequence was selected from the C terminal of TMEM184A. Peptide sequence CQVYAEKKENSPAPPAPMQSISSGIRETVSPQDIVQDAIHNFSPAYQHYT.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TMEM184A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against TMEM184A and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TMEM184A Antibody

  • FLJ24011
  • transmembrane protein 184A

Background

TMEM184A is a multi-pass membrane proteinPotential. It belongs to the UPF0206 family. The exact function of TMEM184A remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37463
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
NBP1-76899
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-30712
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85610
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00006934-M06
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
AF3075
Species: Hu
Applications: WB, ICC
NBP2-61420
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC-P
MAB2568
Species: Mu
Applications: WB, IHC
NBP1-94053
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-82503
Species: Hu
Applications: WB, IHC, IHC-P
AF8107
Species: Hu
Applications: WB, IHC
NBP1-83449
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-81652
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB300-595
Species: Mu, Rt, Bv
Applications: WB, Flow, IHC, IHC-P, IP, IF
H00094234-M07
Species: Hu
Applications: ELISA, ICC/IF
H00005097-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P

Publications for TMEM184A Antibody (NBP1-70728) (0)

There are no publications for TMEM184A Antibody (NBP1-70728).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TMEM184A Antibody (NBP1-70728) (0)

There are no reviews for TMEM184A Antibody (NBP1-70728). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TMEM184A Antibody (NBP1-70728) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TMEM184A Products

Bioinformatics Tool for TMEM184A Antibody (NBP1-70728)

Discover related pathways, diseases and genes to TMEM184A Antibody (NBP1-70728). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TMEM184A Antibody (NBP1-70728)

Discover more about diseases related to TMEM184A Antibody (NBP1-70728).
 

Pathways for TMEM184A Antibody (NBP1-70728)

View related products by pathway.

Blogs on TMEM184A

There are no specific blogs for TMEM184A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TMEM184A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TMEM184A