Recombinant Human TMEM11 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human TMEM11 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 128-192 of Human C17orf35 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:FDPCCKYQVEYDAYKLSRLPLHTLTSSTPVVLVRKDDLHRKRLHNTIALAALVYCVKKIYELYAV

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
TMEM11
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TMEM11 Protein

  • C17orf35
  • chromosome 17 open reading frame 35
  • PM1putative receptor protein
  • PMI
  • Protein PM1
  • Protein PMI
  • transmembrane protein 11

Background

TMEM11 - chromosome 17 open reading frame 35

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02043
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87729
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56561
Species: Hu, Mu, Rt
Applications: WB
NBP1-43312
Species: Mu
Applications: WB, Flow, IHC, IHC-Fr, IHC-P, IP
NB600-501
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Fi, GP, Ha, Le, Ma, Pm, Rb, Sh, Sq, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-04611
Species: Hu
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-57753
Species: Hu
Applications: WB, ICC/IF
H00001446-D01P
Species: Hu, Mu
Applications: WB
AF2667
Species: Hu
Applications: WB, IHC
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85632
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00008834-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for TMEM11 Partial Recombinant Protein (H00008834-Q01) (0)

There are no publications for TMEM11 Partial Recombinant Protein (H00008834-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TMEM11 Partial Recombinant Protein (H00008834-Q01) (0)

There are no reviews for TMEM11 Partial Recombinant Protein (H00008834-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TMEM11 Partial Recombinant Protein (H00008834-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TMEM11 Products

Bioinformatics Tool for TMEM11 Partial Recombinant Protein (H00008834-Q01)

Discover related pathways, diseases and genes to TMEM11 Partial Recombinant Protein (H00008834-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for TMEM11 Partial Recombinant Protein (H00008834-Q01)

View related products by pathway.

Blogs on TMEM11

There are no specific blogs for TMEM11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

TMEM11 Antibody
NBP2-13443

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TMEM11 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TMEM11