![Immunocytochemistry/Immunofluorescence: Myosin IXA Antibody [NBP1-92160] - Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane.](http://images.novusbio.com/fullsize2/Myosin-IXA-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-92160-img0004.jpg "Immunocytochemistry/Immunofluorescence: Myosin IXA Antibody [NBP1-92160] - Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC, IHC-P, PLA |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TSQRFSSVDEQAKLHKTMSQGEITKLAVRQKASDSDIRPQRAKMRFWAKGKQGEKKTTRVKPTTQSEVSPLFAGTDVIPAHQFPDELAA |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | MYO9A |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | Use in PLA reported in scientific literature (PMID:34336885). For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
-Immunohistochemistry-Frozen-NBP2-59690-img0002.jpg)
-Western-Blot-NBP2-59690-img0004.jpg)
-Immunohistochemistry-NBP2-59690-img0006.jpg)
-Immunohistochemistry-NB600-1081-img0004.jpg)
-Immunohistochemistry-NB600-1081-img0003.jpg)
-Immunohistochemistry-Frozen-NB600-1081-img0005.jpg)
| Publication using NBP1-92160 | Applications | Species |
|---|---|---|
| Li Q, Veron D, Tufro A S-Nitrosylation of RhoGAP Myosin9A Is Altered in Advanced Diabetic Kidney Disease Frontiers in Medicine 2021-07-14 [PMID: 34336885] (ICC/IF, PLA) | ICC/IF, PLA |
Secondary Antibodies |
Isotype Controls |
Diseases for Myosin IXA Antibody (NBP1-92160)Discover more about diseases related to Myosin IXA Antibody (NBP1-92160).
| Pathways for Myosin IXA Antibody (NBP1-92160)View related products by pathway.
|
Research Areas for Myosin IXA Antibody (NBP1-92160)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MYO9A |
![Immunohistochemistry-Paraffin: Myosin IXA Antibody [NBP1-92160] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.](http://images.novusbio.com/fullsize2/Myosin-IXA-Antibody-Immunohistochemistry-Paraffin-NBP1-92160-img0002.jpg "Immunohistochemistry-Paraffin: Myosin IXA Antibody [NBP1-92160] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.")
-Western-Blot-H00004646-M02-img0002.jpg)
-Sandwich-ELISA-H00004646-M02-img0001.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")