TM4SF4 Antibody

Immunocytochemistry/Immunofluorescence: TM4SF4 Antibody [NBP2-33464] - Staining of human cell line A549 shows localization to plasma membrane & cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: TM4SF4 Antibody [NBP2-33464] - Staining of human skeletal muscle shows low expression as expected.

Immunohistochemistry-Paraffin: TM4SF4 Antibody [NBP2-33464] - Analysis in human gallbladder and skeletal muscle tissues using Anti-TM4SF4 antibody. Corresponding TM4SF4 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: TM4SF4 Antibody [NBP2-33464] - Staining of human gallbladder shows high expression.

Product Discontinued

TM4SF4 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: INKGPKCLMANSTWGYPFHDGDYLNDEALWNKCREPLNVVPWN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TM4SF4
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (81%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TM4SF4 Antibody

• FLJ31015
• ILTMP
• il-TMP
• ILTMPintestinal and liver (il) tetraspan membrane protein
• Intestine and liver tetraspan membrane protein
• TM4SF4
• transmembrane 4 L six family member 4
• transmembrane 4 L6 family member 4
• transmembrane 4 superfamily member 4

Background

TM4SF4 is encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that can regulate cell proliferation. The use of alternate polyadenylation sites has been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TM4SF4
• Uniprot:
  • P48230()