TJP3 Antibody - BSA Free

Western Blot: TJP3 Antibody [NBP2-85921] - Host: Rabbit. Target Name: TJP3. Sample Tissue: Human 293T Whole Cell lysates. Antibody Dilution: 2ug/ml

Product Discontinued

TJP3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TJP3 Antibody - BSA Free (NBP2-85921) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TJP3. Peptide sequence: GRDLREQERGIIPNQSRAEQLASLEAAQRAVGVGPGSSAGSNARAEFWRL The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TJP3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for TJP3 Antibody - BSA Free

• MGC119546
• tight junction protein 3 (zona occludens 3)
• Tight junction protein 3
• ZO-3
• ZO3tight junction protein ZO-3
• zona occludens 3
• Zona occludens protein 3
• Zonula occludens protein 3

Background

TJP3 - tight junction protein 3 (zona occludens 3)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TJP3