Titin Recombinant Protein Antigen

Images

 
There are currently no images for Titin Protein (NBP1-88071PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Titin Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TTN.

Source: E.coli

Amino Acid Sequence: GTVSTSCYLAVQVSEEFEKETTAVTEKFTTEEKRFVESRDVVMTDTSLTEEQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECKLVISMTFADDAGEYT

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TTN
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-88071.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for Titin Recombinant Protein Antigen

  • cardiomyopathy, dilated 1G (autosomal dominant)
  • CMD1G
  • CMH9
  • CMPD4
  • connectin
  • DKFZp451N061
  • EC 2.7.11.1
  • EOMFC
  • FLJ32040
  • FLJ34413
  • FLJ39564
  • FLJ43066
  • HMERF
  • LGMD2JFLJ26020
  • MPRM
  • Rhabdomyosarcoma antigen MU-RMS-40.14
  • titin
  • TMDFLJ26409

Background

Monoclonal Anti-Titin can be used for study of the elastic filaments within sarcomeric structures. It is also useful as a differentiation marker in the separation of rhabdomyosarcomas from other muscle tumors.By indirect immunofluorescence the antibody displays a typical striated staining pattern on frozen sections of chicken skeletal and cardiac muscle tissues. Stains the region of the A-I junction by indirect immunofluorescence. It shows a decoration line 0.05 mm from the end of the A band in electron micro-graphs.In immunoblotting, using total extracts of chicken breast muscle, the antibody reacts specifically with both bands of the titin double and shows no reaction with nebulin.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB4470
Species: All-Multi
Applications: ICC, IHC, WB
NB120-11099
Species: Al, Am, Av, Bv, Ch, Fi, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, WB
AF3844
Species: Hu, Mu
Applications: IHC
NBP1-31756
Species: Hu
Applications: ICC/IF, WB
NBP1-85544
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP1-88818
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89953
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-15397
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP2-15304
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-80516
Species: Mu, Rt
Applications: IHC, IHC-P, WB
MAB6896
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NB120-6405
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-06983
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, PEP-ELISA, WB
NBP1-33177
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
NB300-543
Species: Am, Bv, Ca, Ma, Fi, Hu, Ma-Mn, Mu, Pm, Rb, Rt, Sh
Applications: B/N, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-31756
Species: Hu
Applications: ICC/IF, WB
NBP1-90091
Species: Hu, Mu
Applications: ICC/IF, IHC-FrFl, IHC, IHC-P
NB300-223
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-88071PEP
Species: Hu
Applications: AC

Publications for Titin Protein (NBP1-88071PEP) (0)

There are no publications for Titin Protein (NBP1-88071PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Titin Protein (NBP1-88071PEP) (0)

There are no reviews for Titin Protein (NBP1-88071PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Titin Protein (NBP1-88071PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Titin Products

Array NBP1-88071PEP

Bioinformatics Tool for Titin Protein (NBP1-88071PEP)

Discover related pathways, diseases and genes to Titin Protein (NBP1-88071PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Titin Protein (NBP1-88071PEP)

Discover more about diseases related to Titin Protein (NBP1-88071PEP).
 

Pathways for Titin Protein (NBP1-88071PEP)

View related products by pathway.

PTMs for Titin Protein (NBP1-88071PEP)

Learn more about PTMs related to Titin Protein (NBP1-88071PEP).
 

Research Areas for Titin Protein (NBP1-88071PEP)

Find related products by research area.

Blogs on Titin

There are no specific blogs for Titin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Titin Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TTN