Recombinant Human Titin GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Product Discontinued
View other related Titin Peptides and Proteins

Order Details


    • Catalog Number
      H00007273-Q02
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Titin GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 26827-26926 of Human Titin

Source: Wheat Germ (in vitro)

Amino Acid Sequence: IRGIPPKIEALPSDISIDEGKVLTVACAFTGEPTPEVTWSCGGRKIHSQEQGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEFGSDSATVNIHIRSI

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
TTN
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Titin GST (N-Term) Protein

  • cardiomyopathy, dilated 1G (autosomal dominant)
  • CMD1G
  • CMH9
  • CMPD4
  • connectin
  • DKFZp451N061
  • EC 2.7.11.1
  • EOMFC
  • FLJ32040
  • FLJ34413
  • FLJ39564
  • FLJ43066
  • HMERF
  • LGMD2JFLJ26020
  • MPRM
  • Rhabdomyosarcoma antigen MU-RMS-40.14
  • titin
  • TMDFLJ26409

Background

This gene encodes a large abundant protein of striated muscle. The product of this gene is divided into two regions, a N-terminal I-band and a C-terminal A-band. The I-band, which is the elastic part of the molecule, contains two regions of tandem immunoglobulin domains on either side of a PEVK region that is rich in proline, glutamate, valine and lysine. The A-band, which is thought to act as a protein-ruler, contains a mixture of immunoglobulin and fibronectin repeats, and possesses kinase activity. A N-terminal Z-disc region and a C-terminal M-line region bind to the Z-line and M-line of the sarcomere respectively so that a single titin molecule spans half the length of a sarcomere. Titin also contains binding sites for muscle associated proteins so it serves as an adhesion template for the assembly of contractile machinery in muscle cells. It has also been identified as a structural protein for chromosomes. Considerable variability exists in the I-band, the M-line and the Z-disc regions of titin. Variability in the I-band region contributes to the differences in elasticity of different titin isoforms and, therefore, to the differences in elasticity of different muscle types. Of the many titin variants identified, five for which complete transcript information is available are described. Mutations in this gene are associated with familial hypertrophic cardiomyopathy 9 and autoantibodies to titin are produced in patients with the autoimmune disease scleroderma. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB4470
Species: All-Multi
Applications: Flow, ICC, IHC, WB
NB120-11099
Species: Al, Am, Av, Bv, Ch, Fi, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, WB
AF3844
Species: Hu, Mu
Applications: IHC
NBP3-35199
Species: Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP1-85544
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP1-88818
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-89953
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P
NBP2-15397
Species: Hu, Mu
Applications: ICC/IF, WB
AF8065
Species: Hu
Applications: WB
NBP2-80516
Species: Mu, Rt
Applications: IHC,  IHC-P, WB
MAB6896
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NB120-6405
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP
NBP1-06983
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, PEP-ELISA, WB
NBP1-33177
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
NB300-543
Species: Am, Bv, Ca, Ma, Fi, Hu, Ma-Mn, Mu, Pm, Rb, Rt, Sh
Applications: B/N, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP3-35199
Species: Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP1-90091
Species: Hu, Mu
Applications: ICC/IF, IHC-FrFl, IHC,  IHC-P
NB300-223
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
H00007273-Q02
Species: Hu
Applications: WB, ELISA, MA, AP

Publications for Titin Partial Recombinant Protein (H00007273-Q02) (0)

There are no publications for Titin Partial Recombinant Protein (H00007273-Q02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Titin Partial Recombinant Protein (H00007273-Q02) (0)

There are no reviews for Titin Partial Recombinant Protein (H00007273-Q02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Titin Partial Recombinant Protein (H00007273-Q02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Titin Products

Research Areas for Titin Partial Recombinant Protein (H00007273-Q02)

Find related products by research area.

Blogs on Titin

There are no specific blogs for Titin, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Titin GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TTN