TINP1 Antibody

Images

 
Immunohistochemistry-Paraffin: TINP1 Antibody [NBP2-13675] - Staining of human cerebellum shows strong nuclear positivity in Purkinje cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TINP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VLSNMIKQKRKEKAGKWEVPLPKVRAQGETEVLKVIRTGKRKKKAWKRMV TKVCFVGDGFTRKPPKYERFIRPMGLRF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NSA2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TINP1 Protein (NBP2-13675PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TINP1 Antibody

  • FLJ94393
  • Hairy cell leukemia protein 1
  • HCLG1
  • HCL-G1
  • HUSSY29
  • HUSSY-29
  • NSA2 ribosome biogenesis homolog (S. cerevisiae)
  • ribosome biogenesis protein NSA2 homolog
  • TGF beta-inducible nuclear protein 1
  • TGF-beta inducible nuclear protein
  • TGF-beta-inducible nuclear protein 1
  • TINP1CDK105
  • YR-29

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85454
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81521
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24449
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow
NBP1-59476
Species: Hu
Applications: WB
H00009771-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
AF4004
Species: Hu, Mu, Rt
Applications: WB, IHC
AF636
Species: Hu, Mu, Rt
Applications: WB, IHC
AF4600
Species: Mu
Applications: WB, IP
NBP1-98280
Species: Hu
Applications: WB
NBP1-55039
Species: Hu
Applications: WB
H00011321-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-84022
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47778
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58953
Species: Hu
Applications: ICC/IF
NBP1-57962
Species: Hu
Applications: WB
NBP2-30659
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
AF7560
Species: Hu, Mu, Rt
Applications: WB
NBP2-13675
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for TINP1 Antibody (NBP2-13675) (0)

There are no publications for TINP1 Antibody (NBP2-13675).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TINP1 Antibody (NBP2-13675) (0)

There are no reviews for TINP1 Antibody (NBP2-13675). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TINP1 Antibody (NBP2-13675) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TINP1 Products

Bioinformatics Tool for TINP1 Antibody (NBP2-13675)

Discover related pathways, diseases and genes to TINP1 Antibody (NBP2-13675). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TINP1 Antibody (NBP2-13675)

Discover more about diseases related to TINP1 Antibody (NBP2-13675).
 

Pathways for TINP1 Antibody (NBP2-13675)

View related products by pathway.

Blogs on TINP1

There are no specific blogs for TINP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TINP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NSA2