We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

TIMM44 Recombinant Protein Antigen

Images

 
There are currently no images for TIMM44 Protein (NBP1-86941PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TIMM44 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TIMM44.

Source: E. coli

Amino Acid Sequence: EVLRKKLGELTGTVKESLHEVSKSDLGRKIKEGVEEAAKTAKQSAESVSKGGEKLGRTAAFRALSQGVESVKKEIDDSVLGQTGPYRRPQRLRKRTEFAGDKF

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TIMM44
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86941.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TIMM44 Recombinant Protein Antigen

  • MIMT44
  • mitochondrial import inner membrane translocase subunit TIM44
  • mitochondrial inner membrane translocase
  • TIM44DKFZp686H05241
  • translocase of inner mitochondrial membrane 44 homolog (yeast)

Background

Essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. Recruits mitochondrial HSP70 to drive protein translocation into the matrix using ATP as an energy source

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00010431-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP1-81696
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-80681
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-40853
Species: Hu
Applications: IHC,  IHC-P, IP, WB
NBP1-31470
Species: Bv, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NB100-2559
Species: Hu
Applications: IHC,  IHC-P, PEP-ELISA, WB
NBP1-87346
Species: Hu
Applications: IHC,  IHC-P
NBP2-37956
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-30865
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-98528
Species: Hu
Applications: WB
NBP1-92298
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
H00001719-M01
Species: Hu, Mu, Rt, Ye
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP3-32621
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-38289
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-33021
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-45570
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
AF6457
Species: Hu
Applications: WB
NBP1-86941PEP
Species: Hu
Applications: AC

Publications for TIMM44 Protein (NBP1-86941PEP) (0)

There are no publications for TIMM44 Protein (NBP1-86941PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TIMM44 Protein (NBP1-86941PEP) (0)

There are no reviews for TIMM44 Protein (NBP1-86941PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TIMM44 Protein (NBP1-86941PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TIMM44 Products

Research Areas for TIMM44 Protein (NBP1-86941PEP)

Find related products by research area.

Blogs on TIMM44.

New Players in the Mitophagy Game
By Christina Towers, PhD Mitochondrial turn over via the lysosome, otherwise known as mitophagy, involves engulfment of mitochondria into double membrane autophagosomes and subsequent fusion with lysosomes. Much is al...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TIMM44 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TIMM44