Tight Junction Protein 2 Antibody [Alexa Fluor® 700]

Images

 
There are currently no images for Tight Junction Protein 2 Antibody (NBP3-35078AF700).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, IP
Clonality
Polyclonal
Host
Rabbit
Conjugate
Alexa Fluor 700

Order Details

Tight Junction Protein 2 Antibody [Alexa Fluor® 700] Summary

Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 951-1190 of human Tight Junction Protein 2 (NP_004808.2).

Sequence:
RSSEPVQHEESIRKPSPEPRAQMRRAASSDQLRDNSPPPAFKPEPPKAKTQNKEESYDFSKSYEYKSNPSAVAGNETPGASTKGYPPPVAAKPTFGRSILKPSTPIPPQEGEEVGESSEEQDNAPKSVLGKVKIFEKMDHKARLQRMQELQEAQNARIEIAQKHPDIYAVPIKTHKPDPGTPQHTSSRPPEPQKAPSRPYQDTRGSYGSDAEEEEYRQQLSEHSKRGYYGQSARYRDTEL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TJP2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoprecipitation
  • Western Blot
Application Notes
Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
Affinity purified

Notes



Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Alternate Names for Tight Junction Protein 2 Antibody [Alexa Fluor® 700]

  • C9DUPq21.11
  • DFNA51
  • DUP9q21.11
  • MGC26306
  • tight junction protein 2 (zona occludens 2)
  • Tight junction protein 2
  • TJP2
  • X104
  • X104tight junction protein ZO-2
  • ZO2
  • ZO-2
  • ZO2Friedreich ataxia region gene X104 (tight junction protein ZO-2)
  • Zona occludens protein 2
  • Zonula occludens protein 2

Background

TJP2 - tight junction protein 2 (zona occludens 2). embers of this family are involved in epithelial and endothelial intercellular junctions. They each contain at least one PSD95/Dlg/ZO-1 (PDZ) domain, a Src homology 3 (SH3) domain, and an enzymatically inactive guanylate kinase domain. PDZ domains are 90-amino acid protein-protein binding domains that recognize at least a 3-residue peptide motif in the COOH termini of their binding partners. PDZ domain-containing proteins, like ZO-2, typically act as scaffolding proteins that organize membrane receptors and cytosolic proteins into multimeric signaling complexes often at the sites of cell-cell contact. The effectiveness and stability of the epithelial barrier depends on a complex of proteins composing different intercellular junctions, which include tight junctions, adherens junctions, and desmosomes. ZO-2 can interact with zona occludens 1 (ZO-1). Furthermore, the PDZ2 domain of ZO-2 was shown to interact with connexin-43, the predominant connexin in epithelial and most other tissues which is involved in cell growth control and embryonic development.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85047
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-87402
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, KD, WB
NBP1-87402
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, KD, WB
NBP2-38696
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00009076-M01
Species: Hu, Pm, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-92405
Species: Hu, Mu, Rt
Applications: WB
NBP2-02259
Species: Hu, Mu, Po, Rt
Applications: ICC/IF
DCP00
Species: Hu
Applications: ELISA
NBP2-00594
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
AF748
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, ICC, IHC, Simple Western, WB
NBP3-18555
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF1329
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
MAB4219
Species: Hu
Applications: CyTOF-ready, Flow
NBP2-53381
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, WB
DVE00
Species: Hu
Applications: ELISA
NBP2-82026
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP3-35078AF700
Species: Hu, Mu
Applications: WB, ELISA, IP

Publications for Tight Junction Protein 2 Antibody (NBP3-35078AF700) (0)

There are no publications for Tight Junction Protein 2 Antibody (NBP3-35078AF700).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Tight Junction Protein 2 Antibody (NBP3-35078AF700) (0)

There are no reviews for Tight Junction Protein 2 Antibody (NBP3-35078AF700). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Tight Junction Protein 2 Antibody (NBP3-35078AF700) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Tight Junction Protein 2 Products

Blogs on Tight Junction Protein 2.

Zonula Occludens (ZO) the Junction Scaffolding Proteins
The Zonula Occludens (ZO) proteins 1,2 and 3, also known as tight junction proteins, are peripheral proteins localizing at junctional sites(1). ZO proteins are known to be scaffolding proteins recruiting various types of proteins to the cytoplasmic...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Tight Junction Protein 2 Antibody [Alexa Fluor® 700] and receive a gift card or discount.

Bioinformatics

Gene Symbol TJP2