We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

TIAL1 Recombinant Protein Antigen

Images

 
There are currently no images for TIAL1 Recombinant Protein Antigen (NBP3-25192PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TIAL1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TIAL1

Source: E.coli

Amino Acid Sequence: SPDMTKNFQQVDYSQWGQWSQVYGNPQQYGQYMANGW

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Protein/Peptide Type
Recombinant Protein Antigen
Gene
TIAL1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-25192It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TIAL1 Recombinant Protein Antigen

  • aging-associated gene 7 protein
  • MGC33401
  • TCBP
  • T-cluster binding protein
  • TIA1 cytotoxic granule-associated RNA binding protein-like 1
  • TIA1 cytotoxic granule-associated RNA-binding protein-like 1
  • TIA-1 related protein
  • TIA-1-related nucleolysin
  • TIA-1-related protein
  • TIARnucleolysin TIAR

Background

TIAL1 is encoded by this gene is a member of a family of RNA-binding proteins, has three RNA recognition motifs (RRMs), and binds adenine and uridine-rich elements in mRNA and pre-mRNAs of a wide range of genes. It regulates various activities including translational control, splicing and apoptosis. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. The different isoforms have been show to function differently with respect to post-transcriptional silencing.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46132
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
H00001994-M02
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB
NBP2-02105
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP3-35586
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-18910
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NB120-13550
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF800
Species: Hu, Mu
Applications: IP, Simple Western, WB
NBP1-77031
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
DADT130
Species: Hu
Applications: ELISA
MAB1230
Species: Hu, Mu, Rt
Applications: ICC, IHC, KO, Simple Western, WB
DVE00
Species: Hu
Applications: ELISA
NBP1-90256
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, WB
NBP2-57100
Species: Hu
Applications: ICC/IF
AF8691
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
H00003347-M01
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB

Publications for TIAL1 Recombinant Protein Antigen (NBP3-25192PEP) (0)

There are no publications for TIAL1 Recombinant Protein Antigen (NBP3-25192PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TIAL1 Recombinant Protein Antigen (NBP3-25192PEP) (0)

There are no reviews for TIAL1 Recombinant Protein Antigen (NBP3-25192PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TIAL1 Recombinant Protein Antigen (NBP3-25192PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TIAL1 Products

Research Areas for TIAL1 Recombinant Protein Antigen (NBP3-25192PEP)

Find related products by research area.

Blogs on TIAL1

There are no specific blogs for TIAL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TIAL1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TIAL1