TIAL1 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

TIAL1 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TIAL1
  
  

  Source: E.coli

  Amino Acid Sequence: SPDMTKNFQQVDYSQWGQWSQVYGNPQQYGQYMANGW

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: TIAL1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-25192It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TIAL1 Recombinant Protein Antigen

• aging-associated gene 7 protein
• MGC33401
• TCBP
• T-cluster binding protein
• TIA1 cytotoxic granule-associated RNA binding protein-like 1
• TIA1 cytotoxic granule-associated RNA-binding protein-like 1
• TIA-1 related protein
• TIA-1-related nucleolysin
• TIA-1-related protein
• TIARnucleolysin TIAR

Background

TIAL1 is encoded by this gene is a member of a family of RNA-binding proteins, has three RNA recognition motifs (RRMs), and binds adenine and uridine-rich elements in mRNA and pre-mRNAs of a wide range of genes. It regulates various activities including translational control, splicing and apoptosis. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. The different isoforms have been show to function differently with respect to post-transcriptional silencing.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TIAL1