Recombinant Human TIA1 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human TIA1 Protein [H00007072-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, In vitro, PA, PAGE, AP

Order Details

Recombinant Human TIA1 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-214 of Human TIA1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MEDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGNDPYCFVEFHEHRHAAAALAAMNGRKIMGKEVKVNWATTPSSQKKDTSSSTVVSTQRSQDHFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKSTYECRCIGEEKEMWNFGEKYARF

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
TIA1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • In vitro assay
  • Protein Array
  • SDS-Page
  • Western Blot
Application Notes
Use in In vitro assay reported in scientific literature (PMID 25013173)
Theoretical MW
49.28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using H00007072-P01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TIA1 GST (N-Term) Protein

  • cytotoxic granule-associated RNA-binding protein
  • nucleolysin TIA-1 isoform p40
  • p40-TIA-1 (containing p15-TIA-1)
  • p40-TIA-1
  • RNA-binding protein TIA-1
  • T-cell-restricted intracellular antigen-1
  • TIA1 cytotoxic granule-associated RNA binding protein
  • TIA1 cytotoxic granule-associated RNA-binding protein
  • TIA-1

Background

TIA1( AAH15944, 1 a.a. - 215 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
NBP1-79932
Species: Hu, Mu, Ze
Applications: ICC/IF, ISH, WB
AF2408
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, KO, Simple Western, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP1-43435
Species: Hu, Mu
Applications: Flow, WB
NBP2-67309
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
7268-CT
Species: Hu
Applications: BA
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
NBP2-46157
Species: Hu
Applications: Flow, IHC, IHC-P, WB
210-TA
Species: Hu
Applications: BA
NBP2-02105
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB100-77417
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, In vivo, WB
NBP2-25200
Species: Hu
Applications: B/N, Flow, IHC, IHC-Fr, WB
H00001994-M02
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
DFS00
Species: Hu
Applications: ELISA
NBP1-19788
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-70360
Species: Hu
Applications: CyTOF-ready, Flow, IMC, ICC/IF, IHC, IHC-P, WB
H00007072-P01
Species: Hu
Applications: WB, ELISA, In vitro, PA, PAGE, AP

Publications for TIA1 Recombinant Protein (H00007072-P01)(1)

We have publications tested in 1 application: In vitro.


Filter By Application
In vitro
(1)
All Applications
Filter By Species
All Species

Reviews for TIA1 Recombinant Protein (H00007072-P01) (0)

There are no reviews for TIA1 Recombinant Protein (H00007072-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TIA1 Recombinant Protein (H00007072-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TIA1 Products

Bioinformatics Tool for TIA1 Recombinant Protein (H00007072-P01)

Discover related pathways, diseases and genes to TIA1 Recombinant Protein (H00007072-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TIA1 Recombinant Protein (H00007072-P01)

Discover more about diseases related to TIA1 Recombinant Protein (H00007072-P01).
 

Pathways for TIA1 Recombinant Protein (H00007072-P01)

View related products by pathway.

PTMs for TIA1 Recombinant Protein (H00007072-P01)

Learn more about PTMs related to TIA1 Recombinant Protein (H00007072-P01).
 

Research Areas for TIA1 Recombinant Protein (H00007072-P01)

Find related products by research area.

Blogs on TIA1

There are no specific blogs for TIA1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TIA1 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TIA1