Thyroglobulin Recombinant Protein Antigen

Images

 
There are currently no images for Thyroglobulin Protein (NBP1-90200PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Thyroglobulin Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TG.

Source: E. coli

Amino Acid Sequence: KMCSADYADLLQTFQVFILDELTARGFCQIQVKTFGTLVSIPVCNNSSVQVGCLTRERLGVNVTWKSRLEDIPVASLPDLHDIERALVGKDLLGRFTDLIQSGSFQLHLDSKTFPAETIRFLQGDHFGTSPRTWFGCSEGFYQVLTSEASQDGLGCVKCPEGS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TG
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90200.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
36 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Thyroglobulin Recombinant Protein Antigen

  • AITD3
  • AITD3TGN
  • cog
  • TDH3
  • Tg
  • TGN
  • Thyroglobulin

Background

Thyroglobulin is synthesized by the follicular epithelial cells of the thyroid. Thyroglobulin is the glycoprotein precursor to the thyroid hormones. Its synthesis and metabolism have seemingly wasteful features. It has a molecular weight of 660,000, with 2 identical subunits of MW 300,000 and 10% sugars; yet its complete hydrolysis yields only 2 to 4 molecules of the iodothyroxines T4 and T3. Baas et al. (1986) showed that the TG gene encodes an 8.7-kb mRNA, covers at least 300 kb of genomic DNA and contains at least 37 exons separated by introns as large as 64 kb. A striking structural difference between the 5-prime and 3-prime parts of the gene suggested that it is composed of 2 evolutionarily different regions. The first 30 kb of DNA encodes 3 kb of the mRNA yielding an exon:intron ratio of 1:10, whereas the remaining 270 kb encodes 5.7 kb of the mRNA with a ratio of 1.47.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2009
Species: Hu
Applications: ICC, IHC
AF7895
Species: Hu
Applications: IHC, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NBP1-80670
Species: Hu
Applications: IHC,  IHC-P, WB
AF7197
Species: Hu, Mu
Applications: ICC, IHC, WB
NBP2-92630
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
AF3664
Species: Hu
Applications: Simple Western, WB
288-TPN/CF
Species: Hu
Applications: BA
NBP2-37477
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
DY1707
Species: Hu
Applications: ELISA
NBP2-46175
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-88057
Species: Hu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB120-14817
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
M6000B
Species: Mu
Applications: ELISA
NBP2-20383
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
202-IL
Species: Hu
Applications: BA

Publications for Thyroglobulin Protein (NBP1-90200PEP) (0)

There are no publications for Thyroglobulin Protein (NBP1-90200PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Thyroglobulin Protein (NBP1-90200PEP) (0)

There are no reviews for Thyroglobulin Protein (NBP1-90200PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Thyroglobulin Protein (NBP1-90200PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Thyroglobulin Products

Research Areas for Thyroglobulin Protein (NBP1-90200PEP)

Find related products by research area.

Blogs on Thyroglobulin.

TTF1 / NKX2.1 - An essential regulator of lung development with implications in cancer diagnostics
Thyroid transcription factor 1 (TTF-1), also known as NKX2.1, is a conserved master regulatory transcription factor involved in the development of the lung, brain, and thyroid (1). In the lung TTF-1 positively regulates the expression of several lu...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Thyroglobulin Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TG