Recombinant Human Thyroglobulin GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human Thyroglobulin Protein [H00007038-Q02] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Product Discontinued
View other related Thyroglobulin Peptides and Proteins

Order Details


    • Catalog Number
      H00007038-Q02
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Thyroglobulin GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 2671-2768 of Human Thyroglobulin

Source: Wheat Germ (in vitro)

Amino Acid Sequence: PYEFSRKVPTFATPWPDFVPRAGGENYKEFSELLPNRQGLKKADCSFWSKYISSLKTSADGAKGGQSAESEEEELTAGSGLREDLLSLQEPGSKTYSK

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
TG
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
36.52 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Thyroglobulin GST (N-Term) Protein

  • AITD3
  • AITD3TGN
  • cog
  • TDH3
  • Tg
  • TGN
  • Thyroglobulin

Background

TG - thyroglobulin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2009
Species: Hu
Applications: ICC, IHC
AF7895
Species: Hu
Applications: IHC, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP2-27544
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
AF7197
Species: Hu, Mu
Applications: ICC, IHC, WB
NBP2-92630
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
210-TA
Species: Hu
Applications: BA
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NBP2-52979
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
288-TPN/CF
Species: Hu
Applications: BA
NBP2-37477
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
DCRP00
Species: Hu
Applications: ELISA
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IF, IHC, IHC-P
NBP2-19860
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB120-14817
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
D6050
Species: Hu
Applications: ELISA
NBP2-20383
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
202-IL
Species: Hu
Applications: BA

Publications for Thyroglobulin Partial Recombinant Protein (H00007038-Q02) (0)

There are no publications for Thyroglobulin Partial Recombinant Protein (H00007038-Q02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Thyroglobulin Partial Recombinant Protein (H00007038-Q02) (0)

There are no reviews for Thyroglobulin Partial Recombinant Protein (H00007038-Q02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Thyroglobulin Partial Recombinant Protein (H00007038-Q02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Thyroglobulin Products

Bioinformatics Tool for Thyroglobulin Partial Recombinant Protein (H00007038-Q02)

Discover related pathways, diseases and genes to Thyroglobulin Partial Recombinant Protein (H00007038-Q02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Thyroglobulin Partial Recombinant Protein (H00007038-Q02)

Discover more about diseases related to Thyroglobulin Partial Recombinant Protein (H00007038-Q02).
 

Pathways for Thyroglobulin Partial Recombinant Protein (H00007038-Q02)

View related products by pathway.

PTMs for Thyroglobulin Partial Recombinant Protein (H00007038-Q02)

Learn more about PTMs related to Thyroglobulin Partial Recombinant Protein (H00007038-Q02).
 

Research Areas for Thyroglobulin Partial Recombinant Protein (H00007038-Q02)

Find related products by research area.

Blogs on Thyroglobulin.

TTF1 / NKX2.1 - An essential regulator of lung development with implications in cancer diagnostics
Thyroid transcription factor 1 (TTF-1), also known as NKX2.1, is a conserved master regulatory transcription factor involved in the development of the lung, brain, and thyroid (1). In the lung TTF-1 positively regulates the expression of several lu...  Read full blog post.

Omicron Variant Antibodies

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Thyroglobulin GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TG