Thymopoietin/LAP2 Antibody


Western Blot: LAP2 Antibody [NBP1-59489] - Human Heart lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

Thymopoietin/LAP2 Antibody Summary

Synthetic peptides corresponding to TMPO(thymopoietin) The peptide sequence was selected from the N terminal of TMPO. Peptide sequence PEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNRP.
Inner-nuclear Membrane Marker
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against TMPO and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Thymopoietin/LAP2 Antibody

  • CMD1T
  • lamina-associated polypeptide 2
  • LAP2PRO0868
  • LEM domain containing 4
  • LEMD4
  • MGC61508
  • Thymopoietin isoform alpha
  • Thymopoietin
  • Thymopoietin, isoforms beta/gamma
  • Thymopoietin-related peptide isoform alpha
  • Thymopoietin-related peptide isoforms beta/gamma
  • TMPO
  • TP alpha
  • TP beta/gamma
  • TP
  • TPRP isoform alpha
  • TPRP isoforms beta/gamma


TMPO may be involved in the structural organization of the nucleus and in the post-mitotic nuclear assembly. It plays an important role, together with LMNA, in the nuclear anchorage of RB1.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
Species: Hu
Applications: WB, Simple Western, Block
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Eq, Mk, Pm
Applications: IHC-P, ICC
Species: Hu, Mu, Po
Applications: WB, Simple Western, ICC/IF
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Mu
Applications: WB, Simple Western
Species: Hu
Applications: IP, CyTOF-ready, ICC, ICFlow
Species: Hu, Pm
Applications: WB, IHC, IHC-P

Publications for Thymopoietin/LAP2 Antibody (NBP1-59489) (0)

There are no publications for Thymopoietin/LAP2 Antibody (NBP1-59489).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Thymopoietin/LAP2 Antibody (NBP1-59489) (0)

There are no reviews for Thymopoietin/LAP2 Antibody (NBP1-59489). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Thymopoietin/LAP2 Antibody (NBP1-59489) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Thymopoietin/LAP2 Antibody Products

Related Products by Gene

Bioinformatics Tool for Thymopoietin/LAP2 Antibody (NBP1-59489)

Discover related pathways, diseases and genes to Thymopoietin/LAP2 Antibody (NBP1-59489). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Thymopoietin/LAP2 Antibody (NBP1-59489)

Discover more about diseases related to Thymopoietin/LAP2 Antibody (NBP1-59489).

Pathways for Thymopoietin/LAP2 Antibody (NBP1-59489)

View related products by pathway.

PTMs for Thymopoietin/LAP2 Antibody (NBP1-59489)

Learn more about PTMs related to Thymopoietin/LAP2 Antibody (NBP1-59489).

Research Areas for Thymopoietin/LAP2 Antibody (NBP1-59489)

Find related products by research area.

Blogs on Thymopoietin/LAP2

There are no specific blogs for Thymopoietin/LAP2, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Thymopoietin/LAP2 Antibody and receive a gift card or discount.


Gene Symbol TMPO

Customers Who Bought This Also Bought