Thymopoietin/LAP2 Antibody

Images

 
Western Blot: LAP2 Antibody [NBP1-59489] - Human Heart lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit

Order Details

Thymopoietin/LAP2 Antibody Summary

Immunogen
Synthetic peptides corresponding to TMPO(thymopoietin) The peptide sequence was selected from the N terminal of TMPO. Peptide sequence PEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNRP.
Marker
Inner-nuclear Membrane Marker
Clonality
Polyclonal
Host
Rabbit
Gene
TMPO
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against TMPO and was validated on Western blot.

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Thymopoietin/LAP2 Antibody

  • CMD1T
  • lamina-associated polypeptide 2
  • LAP2PRO0868
  • LEM domain containing 4
  • LEMD4
  • MGC61508
  • Thymopoietin isoform alpha
  • Thymopoietin
  • Thymopoietin, isoforms beta/gamma
  • Thymopoietin-related peptide isoform alpha
  • Thymopoietin-related peptide isoforms beta/gamma
  • TMPO
  • TP alpha
  • TP beta/gamma
  • TP
  • TPRP isoform alpha
  • TPRP isoforms beta/gamma

Background

TMPO may be involved in the structural organization of the nucleus and in the post-mitotic nuclear assembly. It plays an important role, together with LMNA, in the nuclear anchorage of RB1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45397
Species: Hu
Applications: WB, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-36638
Species: Hu
Applications: IHC, IHC-P
H00001806-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB110-68136
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
MAB5170
Species: Hu
Applications: WB, Simple Western, Block
NBP2-02710
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-42820
Species: Hu, Mu, Rt, Rb
Applications: WB, B/N, IP
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NLS1049
Species: Hu, Eq, Mk, Pm
Applications: IHC-P, ICC
NBP1-71688
Species: Hu, Mu, Po
Applications: WB, Simple Western, ICC/IF
MAB9080
Species: Hu
Applications: WB
NBP1-32421
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF2009
Species: Hu
Applications: WB, IHC
AF4999
Species: Mu
Applications: WB, Simple Western
MAB29051
Species: Hu
Applications: IP, ICC, ICFlow
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP1-59489
Species: Hu
Applications: WB

Publications for Thymopoietin/LAP2 Antibody (NBP1-59489) (0)

There are no publications for Thymopoietin/LAP2 Antibody (NBP1-59489).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Thymopoietin/LAP2 Antibody (NBP1-59489) (0)

There are no reviews for Thymopoietin/LAP2 Antibody (NBP1-59489). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Thymopoietin/LAP2 Antibody (NBP1-59489) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Thymopoietin/LAP2 Antibody Products

Related Products by Gene

Bioinformatics Tool for Thymopoietin/LAP2 Antibody (NBP1-59489)

Discover related pathways, diseases and genes to Thymopoietin/LAP2 Antibody (NBP1-59489). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Thymopoietin/LAP2 Antibody (NBP1-59489)

Discover more about diseases related to Thymopoietin/LAP2 Antibody (NBP1-59489).
 

Pathways for Thymopoietin/LAP2 Antibody (NBP1-59489)

View related products by pathway.

PTMs for Thymopoietin/LAP2 Antibody (NBP1-59489)

Learn more about PTMs related to Thymopoietin/LAP2 Antibody (NBP1-59489).
 

Research Areas for Thymopoietin/LAP2 Antibody (NBP1-59489)

Find related products by research area.

Blogs on Thymopoietin/LAP2

There are no specific blogs for Thymopoietin/LAP2, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol TMPO
Entrez
Uniprot

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-59489 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought