Thromboxane A2 R/TBXA2R Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit Thromboxane A2 R/TBXA2R Antibody - BSA Free (NBP3-10561) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of human Thromboxane A2 R/TBXA2R (NP_001051.1). Peptide sequence EYSGAISAHCNLRLPGSSDSSASACQVAGTTGTRPSWMQPPCLPSRWWAS |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
TBXA2R |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Theoretical MW |
54 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for Thromboxane A2 R/TBXA2R Antibody - BSA Free
Background
The thromboxane A2 receptor (TBXA2R) is a member of the Prostanoid Receptor subfamily. TBXA2R performs an essential role in hemostasis by interacting with thromboxane A2 to induce platelet aggregation. Thromboxane A2 has been implicated in myocardial infarct, stroke, and asthma. Additionally, thromboxane-prostanoid receptors have been implicated in the pathogenesis of cardiovascular diseases. Changes in TBXA2R function have also been linked to a hereditary bleeding disorder. The thromboxane A2 receptor is encoded by a single gene that is alternatively spliced at the carboxyl terminus, resulting in two variants, TP (343 residues) and TP (407 residues) that share the first 328 amino acids.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ICC/IF, IHC, IP, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Bv, Hu, Mu, Rt
Applications: ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, MiAr, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: Flow, ICC/IF, WB
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu, Rt
Applications: IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: ICC, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Publications for Thromboxane A2 R/TBXA2R Antibody (NBP3-10561) (0)
There are no publications for Thromboxane A2 R/TBXA2R Antibody (NBP3-10561).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Thromboxane A2 R/TBXA2R Antibody (NBP3-10561) (0)
There are no reviews for Thromboxane A2 R/TBXA2R Antibody (NBP3-10561).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Thromboxane A2 R/TBXA2R Antibody (NBP3-10561) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Thromboxane A2 R/TBXA2R Products
Research Areas for Thromboxane A2 R/TBXA2R Antibody (NBP3-10561)
Find related products by research area.
|
Blogs on Thromboxane A2 R/TBXA2R