Recombinant Human THEM4 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human THEM4 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 240 of Human THEM4 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MLRSCAARLRTLGALCRPPVGRRLPGSEPRPELRSFSSEEVILKDCSVPNPSWNKDLRLLFDQFMKKCEDGSWKRLPSYKRTPTEWIQDFKTHFLDPKLMKEEQMSQAQLFTRSFDDGLGFEYVMFYNDIEKRMVCLFQGGPYLEGPPGFIHGGAIATMIDATVGMCAMMAGGIVMTANLNINYKRPIPLCSVVMINSQLDKVEGRKFFVSCNVQSVDEKTLYSEATSLFIKLNPAKSLT

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
THEM4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
53.6 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human THEM4 Protein

  • C-terminal modulator protein
  • CTMPCarboxyl-terminal modulator protein
  • MGC29636
  • thioesterase superfamily member 4

Background

Protein kinase B (PKB) is a major downstream target of receptor tyrosine kinases that signal via phosphatidylinositol 3-kinase. Upon cell stimulation, PKB is translocated to the plasma membrane, where it is phosphorylated in the C-terminal regulatory domain. The protein encoded by this gene negatively regulates PKB activity by inhibiting phosphorylation. Transcription of this gene is commonly downregulated in glioblastomas. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-67627
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56074
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF847
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-46403
Species: Hu
Applications: IHC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-38535
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24498
Species: Hu, Mu, Rt, Eq, Pm
Applications: WB, IHC-P
NBP2-45745
Species: Hu
Applications: WB, IHC, IF
NB100-56722
Species: Hu, Ca
Applications: WB, B/N, Flow, ICC/IF, IHC-P, IP, Flow-CS
NB110-55290
Species: Hu, Mu, Rt, Po, Ch
Applications: WB, Simple Western, IHC, IHC-P
NBP2-46234
Species: Hu
Applications: WB, IHC
NB100-2357
Species: Hu, Mu, Pm
Applications: WB, IHC, IHC-P, IP
NBP2-65351
Species: Hu
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB100-2383
Species: Hu
Applications: WB, ICC/IF
H00117145-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for THEM4 Recombinant Protein (H00117145-P01) (0)

There are no publications for THEM4 Recombinant Protein (H00117145-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for THEM4 Recombinant Protein (H00117145-P01) (0)

There are no reviews for THEM4 Recombinant Protein (H00117145-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for THEM4 Recombinant Protein (H00117145-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional THEM4 Products

Bioinformatics Tool for THEM4 Recombinant Protein (H00117145-P01)

Discover related pathways, diseases and genes to THEM4 Recombinant Protein (H00117145-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for THEM4 Recombinant Protein (H00117145-P01)

Discover more about diseases related to THEM4 Recombinant Protein (H00117145-P01).
 

Pathways for THEM4 Recombinant Protein (H00117145-P01)

View related products by pathway.

PTMs for THEM4 Recombinant Protein (H00117145-P01)

Learn more about PTMs related to THEM4 Recombinant Protein (H00117145-P01).

Blogs on THEM4

There are no specific blogs for THEM4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

THEM4 Antibody
NBP1-77360

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human THEM4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol THEM4