THAP7 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: THAP7 Antibody [NBP1-81232] - Immunofluorescent staining of human cell line A-431 shows localization to nuclear membrane & vesicles.
Immunohistochemistry-Paraffin: THAP7 Antibody [NBP1-81232] - Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

THAP7 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GISFHRLPKKDNPRRGLWLANCQRLDPSGQGLWDPASEYIYFCSKHFEEDCFELVGISGYHRLKEGAVPTIFESFSKLRRTTKTKGHSYPPGPPEVSRLRRCRKRCSEGRGPTTPFSPPPPADVTCFP
Specificity
Specificity of human THAP7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
THAP7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
THAP7 Protein (NBP1-81232PEP)
Publications
Read Publication using NBP1-81232.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (89%). Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for THAP7 Antibody

  • MGC10963
  • THAP domain containing 7
  • THAP domain-containing protein 7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-07996
Species: Hu
H00008360-R01
Species: Hu
H00008363-P01
Species: Hu
H00008294-P01
Species: Hu
H00008362-P01
Species: Hu
NB21-2024
Species: Hu, Mu, Rt, Ma
Applications: WB, ChIP, DB, ICC/IF
H00008365-M01
Species: Hu
Applications: ELISA, ICC/IF
NBL1-11567
Species: Hu
NBP1-30888
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-52487
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC, IF
NB100-56628
Species: Hu
Applications: WB
NBP1-85312
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-58824
Species: Hu, Mu
Applications: WB, ChIP, IP, CHIP-SEQ
NB100-1669
Species: Hu
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-30141
Species: Hu, Mu, Rt, Po, Ce, Dr, In, Ma, Ye
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NB100-268
Species: Hu, Rt, Po
Applications: WB, IP
NBP2-33271
Species: Hu
Applications: WB, IHC, IHC-P

Publications for THAP7 Antibody (NBP1-81232)(1)

Reviews for THAP7 Antibody (NBP1-81232) (0)

There are no reviews for THAP7 Antibody (NBP1-81232). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for THAP7 Antibody (NBP1-81232) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for THAP7 Antibody (NBP1-81232)

Discover related pathways, diseases and genes to THAP7 Antibody (NBP1-81232). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for THAP7 Antibody (NBP1-81232)

Discover more about diseases related to THAP7 Antibody (NBP1-81232).
 

Pathways for THAP7 Antibody (NBP1-81232)

View related products by pathway.

PTMs for THAP7 Antibody (NBP1-81232)

Learn more about PTMs related to THAP7 Antibody (NBP1-81232).

Blogs on THAP7

There are no specific blogs for THAP7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our THAP7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol THAP7
Entrez
Uniprot