THADA Antibody - BSA Free

Western Blot: THADA Antibody [NBP2-85907] - Host: Rabbit. Target Name: THADA. Sample Type: MCF7 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

THADA Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit THADA Antibody - BSA Free (NBP2-85907) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human THADA. Peptide sequence: SQVLYKLEQSKSKREPENELTKQHPSVSLQQYKNFMSSICNSLFEALFPG The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: THADA
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for THADA Antibody - BSA Free

• death receptor-interacting protein
• FLJ21877
• FLJ44016
• FLJ44876
• gene inducing thyroid adenomas protein
• KIAA1767
• thyroid adenoma associated
• thyroid adenoma-associated protein

Background

THADA is a gene that codes for a protein that is expressed in many organs including the pancreas, thyroid, and testis, and has five isoforms, with lengths of 1953, 1632, 1897, 674, and 937 amino acids and weights of approximately 220, 183, 211, 76, and 105 kDa respectively. Current research is being done on several diseases and disorders related to this gene including adenoma, thyroiditis, polycystic ovary syndrome, cleft lip/palate, diabetes mellitus, Crohn's disease, prostate cancer, obesity, and prostatitis. THADA has also been shown to have interactions with PRKAA1 and UBC.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: THADA