TfR2 Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human TfR2. Peptide sequence: YVSLDNAVLGDDKFHAKTSPLLTSLIESVLKQVDSPNHSGQTLYEQVVFT The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
TFR2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- Western Blot 1.0 ug/ml
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for TfR2 Antibody - BSA Free
Background
TFR2 is a gene that codes for a protein with three isoforms, with lengths of 801, 630, and 774 amino acids and weights of approximately 89, 70, and 86 kDa respectively. TFR2 helps in the cellular uptake of transferrin-bound iron as well as iron metabolism, erythrocyte differentiation, and hepatocyte function. Current studies are being done on several diseases and disorders related to this gene including porphyria cutanea tarda, iron overload, beta thalassemia, liver cirrhosis, hepatitis C, fatty liver disease, leukemia, lymphoma, liver disease, and cystic fibrosis. TRF2 has also been shown to have interactions with HFE, TF, UBC, and SOCS3 in pathways such as the AMPK enzyme complex and iron metabolism in the placenta pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Bv, Hu, Mu, Po, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu, Po
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB, IHC
Publications for TfR2 Antibody (NBP2-86865) (0)
There are no publications for TfR2 Antibody (NBP2-86865).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for TfR2 Antibody (NBP2-86865) (0)
There are no reviews for TfR2 Antibody (NBP2-86865).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for TfR2 Antibody (NBP2-86865) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional TfR2 Products
Research Areas for TfR2 Antibody (NBP2-86865)
Find related products by research area.
|
Blogs on TfR2