Home » TFPI-2 » TFPI-2 Proteins » TFPI-2 Recombinant Protein Antigen

TFPI-2 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for TFPI-2 Protein (NBP2-33552PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

TFPI-2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TFPI2.

Source: E.coli

Amino Acid Sequence: GNANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQCEGSTEKYFFNLSSMTCE
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TFPI2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-33552.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for TFPI-2 Recombinant Protein Antigen

  • Placental protein 5
  • PP5
  • PP5FLJ21164
  • REF-1
  • TFPI2
  • TFPI-2
  • TFPI-2REF1
  • tissue factor pathway inhibitor 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

APE Antibody
(13B8E5C2) - BSA Free
NB100-116
Immunocytochemistry/Immunofluorescence: APE Antibody (13B8E5C2) [NB100-116] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.05% Triton X-100. The cells were incubated with anti-APE (13B8E5C2) at 5 ug/mL overnight at 4C and detected with an anti-mouse DyLight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Western Blot: APE Antibody (13B8E5C2) [NB100-116] - Whole cell protein from human HeLa, A431, mouse Neuro2A and rat PC12 cells was separated on a 12% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/mL anti-APE-1 in block buffer and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Chromatin Immunoprecipitation (ChIP): APE Antibody (13B8E5C2) [NB100-116] - Association of p53 and APE1 on p53-binding sites in p21 promoter. Re-ChIP analysis (first IP with alpha-APE1 and the second IP with alpha-p53 antibody) showing simultaneous recruitment of APE1 and p53 in control vs. EPE treated cells; *: p value <0.05 (n=2) calculated based on APE1/p53 enriched DNA from control vs. etoposide treated cells. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0068467) licensed under a CC-BY licence.
(3 Reviews)
(99 Publications)
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ChIP, ELISA, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, PLA, Simple Western, WB
TFPI [HRP]
DTFP10
(10 Publications)
Species: Hu
Applications: ELISA
Plasminogen
Antibody
NB600-930
Western Blot: Plasminogen Antibody [NB600-930] - Detection of Plasminogen under reducing (R) and non-reducing (NR) conditions. Reduced samples of purified target proteins contained 4% BME and were boiled for 5 minutes. Samples of 1ug of protein per lane were run by SDS-PAGE. Protein was transferred to nitrocellulose and probed with 1:3000 dilution of primary antibody. Detection shown was using Dylight 649 conjugated Donkey anti goat 1 hr RT.
Western Blot: Plasminogen Antibody [NB600-930] - Lane 1: Plasminogen. Lane 2: None. Load: 50 ng per lane. Primary antibody: Plasminogen primary antibody at 1:1,000 overnight at 4C. Secondary antibody: Peroxidase goat secondary antibody at 1:40,000 for 60 min at RT. Blocking: incubated with blocking buffer for 30 min at RT. Predicted/Observed size: 91 kDa, 91 kDa for Plasminogen. Other band(s): None.
(2 Reviews)
(7 Publications)
Species: Hu, Rt
Applications: ELISA, WB
SP1 Antibody
NB600-232
Western Blot: SP1 Antibody [NB600-232] - A. Whole cell lysate (50 ug for E; 10 ug for T) from HEK 293T cells that were mock transfected (E) or transfected with an Sp1 expression construct (T). B. Whole cell lysate (~700 ug) from HEK 293T cells. A. Affinity purified rabbit anti-Sp1 antibody used at the indicated concentrations. B. SP1 was immunoprecipitated using affinity purified rabbit anti-SP1 antibodies BL937, using each antibody at 3.75 ug/mg lysate. Subsequently, was used at 0.04 ug/mL for WB. Detection by chemiluminescence with an exposure time of 10 seconds (A) or 1 min (B).
Immunohistochemistry-Paraffin: SP1 Antibody [NB600-232] - FFPE sections of human breast carcinoma (left) and mouse squamous cell carcinoma (right). Affinity purified rabbit anti-Sp1 used at a dilution of 1:1,000 (1 ug/mL). Detection by DAB.
Western Blot: SP1 Antibody [NB600-232] - Detection of Human SP1 by Western Blot. Whole cell lysate (50 ug) from HeLa and 293T cells prepared using NETN lysis buffer. Affinity purified rabbit anti-SP1 antibody (NB600-232) used for WB at 0.04 ug/mL. Detection by chemiluminescence with an exposure time of 3 minutes.
(1 Review)
(7 Publications)
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
COCO/DAND5
Antibody (OTI2H3)
NBP2-01223
Flow Cytometry: DAND5 Antibody (2H3) [NBP2-01223] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-DAND5 antibody, and then analyzed by flow cytometry.
Western Blot: DAND5 Antibody (2H3) [NBP2-01223] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY DAND5 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-DAND5.
Immunohistochemistry-Paraffin: DAND5 Antibody (2H3) [NBP2-01223] - Staining of paraffin-embedded Adenocarcinoma of Human breast tissue using anti-DAND5 mouse monoclonal antibody.
Species: Hu
Applications: Flow, IHC, IHC-P, WB
PSG1 [HRP]
DPSG10
(2 Publications)
Species: Hu
Applications: ELISA
Inorganic
Pyrophosphatase/PPA1
NBP1-31348
Immunocytochemistry/Immunofluorescence: Inorganic Pyrophosphatase/PPA1 Antibody [NBP1-31348] - Paraformaldehyde-fixed HeLa, using antibody at 1:200 dilution.
Immunohistochemistry-Paraffin: Inorganic Pyrophosphatase/PPA1 Antibody [NBP1-31348] - Paraffin-embedded OVCAR3 xenograft, using antibody at 1:500 dilution.
Western Blot: Inorganic Pyrophosphatase/PPA1 Antibody [NBP1-31348] - Sample (30 ug of whole cell lysate) A: H1299 B: Hela C: Hep G2 D: Molt-4 12% SDS PAGE; antibody diluted at 1:10000.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
FKBP52/FKBP4
Antibody (5C11)
H00002288-M01
ELISA: FKBP52/FKBP4 Antibody (5C11) [H00002288-M01] - Detection limit for recombinant GST tagged FKBP4 is approximately 1ng/ml as a capture antibody.
Western Blot: FKBP52/FKBP4 Antibody (5C11) [H00002288-M01] - FKBP4 monoclonal antibody (M01), clone 5C11. Analysis of FKBP4 expression in NIH/3T3.
Immunohistochemistry-Paraffin: FKBP52/FKBP4 Antibody (5C11) [H00002288-M01] - Analysis of monoclonal antibody to FKBP4 on formalin-fixed paraffin-embedded human uterine cervix. Antibody concentration 0.5 ug/ml.
(2 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, IP, WB
Coagulation Factor
III/Tissue Factor [HR ...
DCF300
(1 Review)
(22 Publications)
Species: Hu
Applications: ELISA
GR/NR3C1 Antibody
(BuGR2) - BSA Free
NB300-731
Flow Cytometry: GR/NR3C1 Antibody (BuGR2) [NB300-731] - An intracellular stain was performed on Jurkat cells with GR/NR3C1 (BuGR2) antibody NB300-731PE (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Phycoerthrin.
Flow Cytometry: GR/NR3C1 Antibody (BuGR2) [NB300-731] - Using the Alexa Fluor 647 direct conjugate An intracellular stain was performed on HeLa cells with GR/NR3C1 (BuGR2) antibody NB300-731AF647 (blue) and a matched isotype control NB600-986AF647 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
Immunocytochemistry/Immunofluorescence: GR/NR3C1 Antibody (BuGR2) [NB300-731] - Analysis of Glucocorticoid Receptor using Glucocorticoid Receptor Monoclonal Antibody (BuGR2) shows staining in A549 Cells. Glucocorticoid Receptor (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown. Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with an antibody recognizing Glucocorticoid Receptor at a dilution of 1:100 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated.
(3 Reviews)
(12 Publications)
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
TPR Antibody
NB100-2866
Immunocytochemistry/Immunofluorescence: TPR Antibody [NB100-2866] - TPR and Mad1 interaction at the Nuclear Pores (green dots). DNA counterstained with DAPI (blue). Image submitted by a verified customer review.
Knockdown Validated: TPR Antibody [NB100-2866] - Lane 1 contians wildtype MDA-MB-231 cell lysate nuclear extract. Lanes 2, 3 and 4 contain the TPR knocked down MDA-MB-231 cell lysate nuclear extract. The lowered intensity of the bands in knocked down cell lines compared to wildtype supports antibody specificity to intended target protein. Image was submitted by customer review.
Western Blot: TPR Antibody [NB100-2866] - Whole cell lysate from HeLa (5, 15 and 50 ug) and HEK293T (T; 50 ug) cells. Antibodies: Affinity purified rabbit anti-TPR antibody used for WB at 0.04 ug/ml. Detection: Chemiluminescence with exposure time of 30 seconds.
(2 Reviews)
(4 Publications)
Species: Hu
Applications: ICC/IF, IP, KD, WB
HSP90 alpha
Antibody - BSA Free
NBP1-77685
Simple Western: HSP90 alpha Antibody [NBP1-77685] - Image shows a specific band for Hsp90A in 0.5 mg/mL of HepG2 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
Immunocytochemistry/Immunofluorescence: HSP90 alpha Antibody [NBP1-77685] - HSP901a antibody was tested in MCF-7 cells with FITC (green). Nuclei and actin were counterstained with DAPI (blue) and Phalloidin (red).
Immunohistochemistry: HSP90 alpha Antibody [NBP1-77685] - Staining of human kidney carcinoma in HSP901A using DAB with hematoxylin counterstain.
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
PPP2R4 Antibody
NBP1-87232
Western Blot: PPP2R4 Antibody [NBP1-87232] - Analysis in human cell line SiHa.
Immunohistochemistry-Paraffin: PPP2R4 Antibody [NBP1-87232] - Staining of human cerebral cortex shows moderate cytoplasmic and nuclear positivity in neuronal cells.
Immunohistochemistry-Paraffin: PPP2R4 Antibody [NBP1-87232] - Staining of human kidney shows moderate cytoplasmic and nuclear positivity in cells in tubules.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
CSH2 Antibody
NBP2-16019
Western Blot: CSH2 Antibody [NBP2-16019] - Sample (30 ug of whole cell lysate) A: A549 B: H1299 C: HCT116 D: MCF-7 12% SDS PAGE gel, diluted at 1:1000.
Immunohistochemistry-Paraffin: CSH2 Antibody [NBP2-16019] - Immunohistochemical analysis of paraffin-embedded Colon ca, using antibody at 1:500 dilution.
Species: Hu
Applications: IHC, IHC-P, WB
Placental
Lactogen/CSH1 Antibod ...
NBP2-46376
Immunohistochemistry: Placental Lactogen/CSH1 Antibody (2G4) [NBP2-46376] - Analysis of Human breast tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Immunohistochemistry: Placental Lactogen/CSH1 Antibody (2G4) [NBP2-46376] - Analysis of Adenocarcinoma of Human colon tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Immunohistochemistry: Placental Lactogen/CSH1 Antibody (2G4) [NBP2-46376] - Analysis of Human Kidney tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Species: Hu
Applications: IHC, WB
Holo-Transferrin
2914-HT
Holo-Transferrin
(4 Reviews)
(33 Publications)
Species: Hu
Applications: BA
ASK1 Antibody
(SU36-06)
NBP2-67481
Flow Cytometry: ASK1 Antibody (SU36-06) [NBP2-67481] - Analysis of Hela cells with ASK1 antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.
Immunocytochemistry/Immunofluorescence: ASK1 Antibody (SU36-06) [NBP2-67481] - Staining ASK1 in A549 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: ASK1 Antibody (SU36-06) [NBP2-67481] - Staining ASK1 in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry: p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on HeLa cells with p53 (PAb240) NB200-103AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
Flow Cytometry: p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on A549 cells with p53 (PAb240) NB200-103AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
Flow (Intracellular): p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on HeLa cells with p53 (PAb240) NB200-103 (blue) and a matched isotype control NBP2-27287 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by APC-conjugated anti-mouse IgG secondary antibody F0101B.
(3 Reviews)
(33 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB

Publications for TFPI-2 Protein (NBP2-33552PEP) (0)

There are no publications for TFPI-2 Protein (NBP2-33552PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TFPI-2 Protein (NBP2-33552PEP) (0)

There are no reviews for TFPI-2 Protein (NBP2-33552PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TFPI-2 Protein (NBP2-33552PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TFPI-2 Products

Bioinformatics Tool for TFPI-2 Protein (NBP2-33552PEP)

Discover related pathways, diseases and genes to TFPI-2 Protein (NBP2-33552PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TFPI-2 Protein (NBP2-33552PEP)

Discover more about diseases related to TFPI-2 Protein (NBP2-33552PEP).
 

Pathways for TFPI-2 Protein (NBP2-33552PEP)

View related products by pathway.

PTMs for TFPI-2 Protein (NBP2-33552PEP)

Learn more about PTMs related to TFPI-2 Protein (NBP2-33552PEP).

Blogs on TFPI-2

There are no specific blogs for TFPI-2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Immunocytochemistry/Immunofluorescence: APE Antibody (13B8E5C2) [NB100-116] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.05% Triton X-100. The cells were incubated with anti-APE (13B8E5C2) at 5 ug/mL overnight at 4C and detected with an anti-mouse DyLight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
APE Antibody (13B8E5C2) - BSA Free
NB100-116
Flow Cytometry: p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on HeLa cells with p53 (PAb240) NB200-103AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
p53 Antibody (PAb 240) - BSA Free
NB200-103
Holo-Transferrin
2914-HT-100MG

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TFPI-2 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol TFPI2