TFIIIC Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TFIIIC Antibody [NBP2-14077] - Immunofluorescent staining of human cell line A-431 shows localization to nucleus & nucleoli.
Immunohistochemistry-Paraffin: TFIIIC Antibody [NBP2-14077] - Staining of human salivary gland shows strong nuclear and cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TFIIIC Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QVFIFLKKNAVIVDTTICDPHYNLARSSRPFERRLYVLNSMQDVENYWFD LQCVCLNTPLGVVRCPRVRKNSSTDQGSDEEGSLQKEQESAMDKHNLERK CAMLEYTTGSREVVDEGLIPGDGLGAAGLDSSFYG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GTF3C1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100.
Control Peptide
TFIIIC Protein (NBP2-14077PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TFIIIC Antibody

  • general transcription factor 3C polypeptide 1
  • general transcription factor IIIC, polypeptide 1 (alpha subunit)
  • general transcription factor IIIC, polypeptide 1 (alpha subunit, 220kD )
  • general transcription factor IIIC, polypeptide 1, alpha 220kDa
  • TF3C-alpha
  • TFIIIC 220 kDa subunit
  • TFIIIC box B-binding subunit
  • TFIIIC
  • TFIIIC220DKFZp686A111
  • TFIIICalpha
  • Transcription factor IIIC 220 kDa subunit
  • Transcription factor IIIC subunit alpha

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-55335
Species: Hu
Applications: WB, ICC/IF
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
NBP1-89064
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88667
Species: Hu
Applications: IHC, IHC-P
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP2-15139
Species: Hu
Applications: WB, IHC, IHC-P
H00055814-R01
Species: Hu
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-84999
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-32550
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
H00026469-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-34143
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2866
Species: Hu
Applications: WB, ICC/IF, IP, PLA
H00009330-M01
Species: Hu, Mu
Applications: WB, ELISA
NB100-60429
Species: Hu
Applications: WB, IHC, IHC-P, IP

Publications for TFIIIC Antibody (NBP2-14077) (0)

There are no publications for TFIIIC Antibody (NBP2-14077).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TFIIIC Antibody (NBP2-14077) (0)

There are no reviews for TFIIIC Antibody (NBP2-14077). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TFIIIC Antibody (NBP2-14077) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TFIIIC Products

Bioinformatics Tool for TFIIIC Antibody (NBP2-14077)

Discover related pathways, diseases and genes to TFIIIC Antibody (NBP2-14077). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TFIIIC Antibody (NBP2-14077)

Discover more about diseases related to TFIIIC Antibody (NBP2-14077).
 

Pathways for TFIIIC Antibody (NBP2-14077)

View related products by pathway.

Blogs on TFIIIC

There are no specific blogs for TFIIIC, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TFIIIC Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GTF3C1