TFIIIC Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: TFIIIC Antibody [NBP2-14077] - Immunofluorescent staining of human cell line A-431 shows localization to nucleus & nucleoli. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: TFIIIC Antibody [NBP2-14077] - Staining of human salivary gland shows strong nuclear and cytoplasmic positivity in glandular cells.

ChIP-Exo-Seq composite graph for Anti-GTF3C1 (NBP2-14077) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

• Reactivity: Hu
• Applications: ICC/IF, IHC, ChIP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TFIIIC Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TFIIIC Antibody - BSA Free (NBP2-14077) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: QVFIFLKKNAVIVDTTICDPHYNLARSSRPFERRLYVLNSMQDVENYWFDLQCVCLNTPLGVVRCPRVRKNSSTDQGSDEEGSLQKEQESAMDKHNLERKCAMLEYTTGSREVVDEGLIPGDGLGAAGLDSSFYG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GTF3C1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation-exo-Seq 1-10ug per reaction
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. For ICC/IF,Fixation/Permeabilization: PFA/Triton X-100.
• Control Peptide:

  TFIIIC Protein (NBP2-14077PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (87%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for TFIIIC Antibody - BSA Free

• general transcription factor 3C polypeptide 1
• general transcription factor IIIC, polypeptide 1 (alpha subunit)
• general transcription factor IIIC, polypeptide 1 (alpha subunit, 220kD )
• general transcription factor IIIC, polypeptide 1, alpha 220kDa
• TF3C-alpha
• TFIIIC 220 kDa subunit
• TFIIIC box B-binding subunit
• TFIIIC
• TFIIIC220DKFZp686A111
• TFIIICalpha
• Transcription factor IIIC 220 kDa subunit
• Transcription factor IIIC subunit alpha

Background

General transcription factor 3C polypeptide 1 (GTF3C1/TFIIIC220) is a subunit of the TFIIIC DNA-binding factor required for transcription of tRNA and 5S rRNA genes by RNA polymerase III. Human TFIIIC is composed of six subunits: TFIIIC220, TFIIIC110, TFIIIC102, TFIIIC90 and TFIIIC63, and TFIIIC35. The functional contribution of GTF3C1/TFIIIC220 to the TFIIIC complex has not been fully determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GTF3C1