TFEC Antibody (4F11) - Azide and BSA Free

Western Blot: TFEC Antibody (4F11) [H00022797-M08] - Analysis of TFEC expression in transfected 293T cell line by TFEC monoclonal antibody (M08), clone 4F11. Lane 1: TFEC transfected lysatE (22.7 KDa). Lane 2: Non-transfected lysate.

Sandwich ELISA: TFEC Antibody (4F11) [H00022797-M08] - Detection limit for recombinant GST tagged TFEC is 0.1 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 4F11
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

TFEC Antibody (4F11) - Azide and BSA Free Summary

• Immunogen: TFEC (NP_001018068.1, 1 a.a. ~ 89 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MTLDHQIINPTLKWSQPAVPSGGPLVQHAHTTLDSDAGLTENPLTKLLAIGKEDDNAQWHLSGSILDVYSGEQGISPINMGLTSASCPS
• Specificity: TFEC - transcription factor EC (4F11)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: TFEC
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactive against transfected lysate and recombinant protein for western blot. It has also been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TFEC Antibody (4F11) - Azide and BSA Free

• Class E basic helix-loop-helix protein 34
• hTFEC-L
• TCFECTFECLbHLHe34BHLHE34
• TFE-C
• transcription factor EC
• Transcription factor EC-like

Background

Transcriptional regulator that acts as a repressor or an activator. Acts as a transcriptional repressor on minimal promoter containing element F (that includes an E-box sequence). Binds to element F in an E-box sequence-specific manner. Acts as a transcriptional transactivator on the proximal promoter region of the tartrate-resistant acid phosphatase (TRAP) E-box containing promoter . Collaborates with MITF in target gene activation . Acts as a transcriptional repressor on minimal promoter containing mu E3 enhancer sequence . Binds to mu E3 DNA sequence of the immunoglobulin heavy-chain gene enhancer . Binds DNA in a homo- or heterodimeric form

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TFEC
• Entrez:
  • 22797(Human)
• Uniprot:
  • NP_001018068(Human)