| Reactivity | HuSpecies Glossary |
| Applications | AC |
| Description | A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TFEB Source: E.coli Amino Acid Sequence: YHLQQSQHQKVREYLSETYGNKFAAHISPAQGSPKPPPAASPGVRAGHVLSSSAGNSAPN Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) |
| Protein/Peptide Type | Recombinant Protein Antigen |
| Gene | TFEB |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
| Dilutions |
|
| Application Notes | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-25187It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Preservative | No Preservative |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
Research Areas for TFEB Recombinant Protein Antigen (NBP3-25187PEP)Find related products by research area.
|
|
Epigenetic Control of Autophagy By Christina Towers, PhD. In the last 20 years, epigenetic regulation has become front and center for almost all fields of biology and its role in diseases like cancer and neurodegeneration are being heavily studi... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TFEB |
![Immunohistochemistry-Paraffin TOR/mTOR [p Ser2448] Antibody - BSA Free](https://images.novusbio.com/images/TOR-mTOR-[p-Ser2448]-Antibody-Immunohistochemistry-Paraffin-NB600-607-img0005.jpg)
![Western Blot TOR/mTOR [p Ser2448] Antibody - BSA Free](https://images.novusbio.com/images/TOR-mTOR-[p-Ser2448]-Antibody-Western-Blot-NB600-607-img0006.jpg)
![Data TOR/mTOR [p Ser2448] Antibody - BSA Free](https://images.novusbio.com/images/TOR-mTOR-[p-Ser2448]-Antibody-N-A-NB600-607-img0008.jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![N/A ERK1 [p Thr202, p Tyr204] [Biotin]](https://images.novusbio.com/images2/dyc1825-2_phospho-erk1-duoset-ic-economy-pack-15-plate-17122020121349.png)
![N/A ERK1 [p Thr202, p Tyr204] [Biotin]](https://images.novusbio.com/images2/dyc1825-2_phospho-erk1-duoset-ic-economy-pack-15-plate-17122020122737.png)
![N/A ERK1 [p Thr202, p Tyr204] [Biotin]](https://images.novusbio.com/images2/dyc1825-2_phospho-erk1-duoset-ic-economy-pack-15-plate-17122020122919.png)
![Western Blot S100A10 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A10_AF2377_Western_Blot_17324.jpg)
![Immunohistochemistry S100A10 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A10_AF2377_Immunohistochemistry_17440.jpg)
![Simple Western S100A10 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A10_AF2377_Simple_Western_18705.jpg)
![Western Blot: TFEB Antibody (S1) [H00007942-M01] - TFEB expression reduces PHF1 levels in the P301S model of tauopathy, & significantly attenuates the loss of neuronal & synaptic markers in the hippocampus. A, Lysates were prepared from the hippocampal regions of WT, P301S, & P301S/flag-TFEB mice, & were subjected to immunoblotting. B, Quantitation by ImageJ revealed PHF1 levels of 436% in the P301S mice compared with WT controls, which were significantly attenuated to 212% in the P301S/flag-TFEB double-transgenic mice. However, TFEB expression did not alter the levels of total tau, which remained similar in the P301S & the double-transgenic mice. NeuN levels were reduced by 25% in the P301S mice, which was significantly reversed to WT levels in the double-transgenic mice. Similarly, spinophilin levels were reversed from 40% reduction to 6% due to TFEB overexpression. TFEB expression also increased LAMP1 levels by 207% & cathepsin D levels by 33% in the P301S/flag-TFEB mice compared with WT controls. Statistical analysis by one-way ANOVA followed by Student–Newman–Keuls post hoc test revealed significant differences. *p < 0.05, **p < 0.01, & ***p < 0.001, compared with WT controls; $$p < 0.01, $$$p < 0.001, compared with P301S mice. The data are reported as the mean ± SEM. n = 4 WT mice; n = 5 P301S & P301S/flag-TFEB mice. Image collected & cropped by CiteAb from the following publication (https://www.eneuro.org/lookup/doi/10.1523/ENEURO.0042-16.2016), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](https://images.novusbio.com/images/h00007942-m01_mouse-monoclonal-tfeb-antibody-s1-310202415482238.jpg "Western Blot: TFEB Antibody (S1) [H00007942-M01] - TFEB expression reduces PHF1 levels in the P301S model of tauopathy, & significantly attenuates the loss of neuronal & synaptic markers in the hippocampus. A, Lysates were prepared from the hippocampal regions of WT, P301S, & P301S/flag-TFEB mice, & were subjected to immunoblotting. B, Quantitation by ImageJ revealed PHF1 levels of 436% in the P301S mice compared with WT controls, which were significantly attenuated to 212% in the P301S/flag-TFEB double-transgenic mice. However, TFEB expression did not alter the levels of total tau, which remained similar in the P301S & the double-transgenic mice. NeuN levels were reduced by 25% in the P301S mice, which was significantly reversed to WT levels in the double-transgenic mice. Similarly, spinophilin levels were reversed from 40% reduction to 6% due to TFEB overexpression. TFEB expression also increased LAMP1 levels by 207% & cathepsin D levels by 33% in the P301S/flag-TFEB mice compared with WT controls. Statistical analysis by one-way ANOVA followed by Student–Newman–Keuls post hoc test revealed significant differences. *p < 0.05, **p < 0.01, & ***p < 0.001, compared with WT controls; $$p < 0.01, $$$p < 0.001, compared with P301S mice. The data are reported as the mean ± SEM. n = 4 WT mice; n = 5 P301S & P301S/flag-TFEB mice. Image collected & cropped by CiteAb from the following publication (https://www.eneuro.org/lookup/doi/10.1523/ENEURO.0042-16.2016), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")