TFCP2L1 Antibody

Western Blot: TFCP2L1 Antibody [NBP1-85441] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Immunohistochemistry-Paraffin: TFCP2L1 Antibody [NBP1-85441] - Staining of human kidney shows nuclear and nucleolar positivity.

Product Discontinued

TFCP2L1 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: QVNSAPSPSYNGSPNSFGLGEGNASPTHPVEALPVGSDHLLPSASIQDAQQWLHRNRFSQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TFCP2L1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (87%). Reactivity reported in scientific literature (PMID: 23227862)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TFCP2L1 Antibody

• CRTR1
• CRTR1CRTR-1
• LBP9
• LBP-9
• LBP9CP2-related transcriptional repressor 1
• TFCP2L1
• transcription factor CP2-like 1
• transcription factor CP2-like protein 1
• Transcription factor LBP-9

Background

CP2-related proteins are a family of DNA-binding transcription factors that are generally activators of transcription and expressed ubiquitously. A novel CP2 family member, CP2-Related Transcriptional Repressor-1 (CRTR-1), is expressed in a developmentally regulated fashion in vivo and acts as a direct repressor of transcription.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TFCP2L1 Antibody (NBP1-85441)(2)

Publications using NBP1-85441

• Mathieu J, Detraux D, Kuppers D et al. Folliculin regulates mTORC1/2 and WNT pathways in early human pluripotency Nat Commun 2019-02-07 [PMID: 30733432] (WB, Human)
• Danielsson F, Wiking M, Mahdessian D et al. RNA deep sequencing as a tool for selection of cell lines for systematic subcellular localization of all human proteins. J Proteome Res 2013-01-04 [PMID: 23227862]

Bioinformatics

• Gene Symbol: TFCP2L1