TFCP2L1 Antibody


Western Blot: TFCP2L1 Antibody [NBP1-85441] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: TFCP2L1 Antibody [NBP1-85441] - Staining of human kidney shows nuclear and nucleolar positivity.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

TFCP2L1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: QVNSAPSPSYNGSPNSFGLGEGNASPTHPVEALPVGSDHLLPSASIQDAQQWLHRNRFSQ
Specificity of human TFCP2L1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TFCP2L1 Protein (NBP1-85441PEP)
Read Publication using NBP1-85441.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (87%). Reactivity reported in scientific literature (PMID: 23227862)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for TFCP2L1 Antibody

  • CRTR1
  • LBP9
  • LBP-9
  • LBP9CP2-related transcriptional repressor 1
  • TFCP2L1
  • transcription factor CP2-like 1
  • transcription factor CP2-like protein 1
  • Transcription factor LBP-9


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Ca
Applications: IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, IHC, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, ChIP
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Mu, Am
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, Neut
Species: Hu
Species: Mu
Applications: WB, IHC

Publications for TFCP2L1 Antibody (NBP1-85441)(1)

Reviews for TFCP2L1 Antibody (NBP1-85441) (0)

There are no reviews for TFCP2L1 Antibody (NBP1-85441). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TFCP2L1 Antibody (NBP1-85441) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional TFCP2L1 Products

Bioinformatics Tool for TFCP2L1 Antibody (NBP1-85441)

Discover related pathways, diseases and genes to TFCP2L1 Antibody (NBP1-85441). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TFCP2L1 Antibody (NBP1-85441)

Discover more about diseases related to TFCP2L1 Antibody (NBP1-85441).

Pathways for TFCP2L1 Antibody (NBP1-85441)

View related products by pathway.

PTMs for TFCP2L1 Antibody (NBP1-85441)

Learn more about PTMs related to TFCP2L1 Antibody (NBP1-85441).

Research Areas for TFCP2L1 Antibody (NBP1-85441)

Find related products by research area.

Blogs on TFCP2L1

There are no specific blogs for TFCP2L1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TFCP2L1 Antibody and receive a gift card or discount.


Gene Symbol TFCP2L1