tescalcin Antibody

Images

 
Western Blot: tescalcin Antibody [NBP2-83640] - Host: Rabbit. Target Name: TESC. Sample Type: Jurkat Whole Cell lysates. Antibody Dilution: 1.0ug/mlTESC is supported by BioGPS gene expression data to be expressed in ...read more

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, Gp, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

tescalcin Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human tescalcin. Peptide sequence: DSDGRITLEEYRNVVEELLSGNPHIEKESARSIADGAMMEAASVCMGQME The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (100%), Rabbit (100%), Guinea Pig (100%), Equine (100%), Canine (100%), Bovine (100%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
TESC
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for tescalcin Antibody

  • calcineurin B homologous protein 3
  • CHP3
  • TSC

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67552
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NBP2-46234
Species: Hu, Mu, Rt
Applications: WB, IHC
NB600-607
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-44270
Species: Mu, Rt
Applications: WB, EM, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu, Rt, Rb
Applications: WB, IHC, IHC-P
NBP2-75646
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB847
Species: Hu, Mu
Applications: WB, IHC, CyTOF-ready, ICFlow, KO
NB100-1595
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-76847
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-24503
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB600-1049
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80993
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19804
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
NBP2-46404
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22127
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-87799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-81529
Species: Hu, Mu, Rt, Po, Ma-Op, Pm, Rb
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IP, KD, KO

Publications for tescalcin Antibody (NBP2-83640) (0)

There are no publications for tescalcin Antibody (NBP2-83640).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for tescalcin Antibody (NBP2-83640) (0)

There are no reviews for tescalcin Antibody (NBP2-83640). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for tescalcin Antibody (NBP2-83640) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional tescalcin Products

Bioinformatics Tool for tescalcin Antibody (NBP2-83640)

Discover related pathways, diseases and genes to tescalcin Antibody (NBP2-83640). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for tescalcin Antibody (NBP2-83640)

Discover more about diseases related to tescalcin Antibody (NBP2-83640).
 

Pathways for tescalcin Antibody (NBP2-83640)

View related products by pathway.

Blogs on tescalcin

There are no specific blogs for tescalcin, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our tescalcin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TESC