TEF1 Recombinant Protein Antigen

Images

 
There are currently no images for TEF1 Recombinant Protein Antigen (NBP2-56713PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TEF1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TEF1.

Source: E. coli

Amino Acid Sequence: VSATAIHNKLGLPGIPRPTFPGAPGFWPGMIQTGQPGSSQDVKPFVQQAYPIQPAVTAPIPGFEPASA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TEAD1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50354.It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com For further blocking peptide related information and a protocol, click here.
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for TEF1 Recombinant Protein Antigen

  • NTEF-1
  • Protein GT-IIC
  • TCF13
  • TCF-13
  • TEA domain family member 1 (SV40 transcriptional enhancer factor)
  • TEAD1
  • TEAD-1
  • TEF1

Background

TEF1 binds specifically and cooperatively to the SPH and GT IIC quot enhansons quot; (GTGGAATGT) and activates transcription in vivo in a cell specific manner. The activation function appears to be mediated by a limiting cell specific transcriptional intermediary factor (TIF). It is involved in cardiac development and also binds to the MCAT motif.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

210-TA
Species: Hu
Applications: BA
MAB5018
Species: Hu
Applications: IP, WB
NBP1-88866
Species: Hu
Applications: IHC, IHC-P
NBP1-76544
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, Simple Western, WB
H00151056-B01P
Species: Hu, Mu
Applications: WB
MAB2669
Species: Hu
Applications: IHC, Simple Western, WB
NB100-689
Species: Hu, Rt
Applications: IHC, IHC-Fr, IHC-P, Simple Western, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
D6050
Species: Hu
Applications: ELISA
DY417
Species: Mu
Applications: ELISA
NBP1-89296
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF4925
Species: Mu
Applications: IHC, Simple Western, WB
H00008398-D01P
Species: Hu, Mu
Applications: WB
DTM100
Species: Hu
Applications: ELISA
NBP1-32550
Species: Hu, Mu, Ze
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-31344
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-59438
Species: Hu
Applications: ELISA, ICC/IF, WB

Publications for TEF1 Recombinant Protein Antigen (NBP2-56713PEP) (0)

There are no publications for TEF1 Recombinant Protein Antigen (NBP2-56713PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TEF1 Recombinant Protein Antigen (NBP2-56713PEP) (0)

There are no reviews for TEF1 Recombinant Protein Antigen (NBP2-56713PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TEF1 Recombinant Protein Antigen (NBP2-56713PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TEF1 Products

Array NBP2-56713PEP

Bioinformatics Tool for TEF1 Recombinant Protein Antigen (NBP2-56713PEP)

Discover related pathways, diseases and genes to TEF1 Recombinant Protein Antigen (NBP2-56713PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TEF1 Recombinant Protein Antigen (NBP2-56713PEP)

Discover more about diseases related to TEF1 Recombinant Protein Antigen (NBP2-56713PEP).
 

Pathways for TEF1 Recombinant Protein Antigen (NBP2-56713PEP)

View related products by pathway.

PTMs for TEF1 Recombinant Protein Antigen (NBP2-56713PEP)

Learn more about PTMs related to TEF1 Recombinant Protein Antigen (NBP2-56713PEP).
 

Research Areas for TEF1 Recombinant Protein Antigen (NBP2-56713PEP)

Find related products by research area.

Blogs on TEF1.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TEF1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TEAD1