![Western Blot: TEAD3 Antibody [NBP2-85896] - WB Suggested Anti-TEAD3 Antibody Titration: 0.2-1 ug/ml. Positive Control: HepG2 cell lysateTEAD3 is supported by BioGPS gene expression data to be expressed in HepG2](http://images.novusbio.com/fullsize/TEAD3-Antibody-Western-Blot-NBP2-85896-img0002.jpg "Western Blot: TEAD3 Antibody [NBP2-85896] - WB Suggested Anti-TEAD3 Antibody Titration: 0.2-1 ug/ml. Positive Control: HepG2 cell lysateTEAD3 is supported by BioGPS gene expression data to be expressed in HepG2")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Concentration | 0.5 mg/ml |
| Description | Novus Biologicals Rabbit TEAD3 Antibody - BSA Free (NBP2-85896) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of human TEAD3. Peptide sequence: MMNSVLENFTILQVVTSRDSQETLLVIAFVFEVSTSEHGAQHHVYKLVKD The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TEAD3 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
![Western Blot HIC5/TGFB1I1 Antibody [Unconjugated]](https://images.novusbio.com/images2/HIC5_AF5626_Western_Blot_5782.jpg)
![Immunocytochemistry HIC5/TGFB1I1 Antibody [Unconjugated]](https://images.novusbio.com/images2/HIC5_AF5626_Immunocytochemistry__Immunofluorescence_19725.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for TEAD3 Antibody (NBP2-85896)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TEAD3 |
![Immunohistochemistry: TEAD3 Antibody [NBP2-85896] - Human Intestine](http://images.novusbio.com/fullsize/TEAD3-Antibody-Immunohistochemistry-NBP2-85896-img0001.jpg "Immunohistochemistry: TEAD3 Antibody [NBP2-85896] - Human Intestine")
![Western Blot: TEAD3 Antibody [NBP2-85896] - Host: Rabbit. Target Name: TEAD3. Sample Tissue: Human A549 Whole Cell. Antibody Dilution: 1ug/ml](http://images.novusbio.com/fullsize/TEAD3-Antibody-Western-Blot-NBP2-85896-img0003.jpg "Western Blot: TEAD3 Antibody [NBP2-85896] - Host: Rabbit. Target Name: TEAD3. Sample Tissue: Human A549 Whole Cell. Antibody Dilution: 1ug/ml")
![Western Blot NKX2.5 Antibody [Unconjugated]](https://images.novusbio.com/images/af2444_human-nkx2-5-affinity-purified-polyclonal-ab-4120241239327.jpg)
![Immunocytochemistry/ Immunofluorescence NKX2.5 Antibody [Unconjugated]](https://images.novusbio.com/images/af2444_human-nkx2-5-affinity-purified-polyclonal-ab-41202412401270.jpg)
![Immunocytochemistry/ Immunofluorescence NKX2.5 Antibody [Unconjugated]](https://images.novusbio.com/images/af2444_human-nkx2-5-affinity-purified-polyclonal-ab-41202412403531.jpg)
![Western Blot Atrial Natriuretic Peptide/ANP Antibody [Unconjugated]](https://images.novusbio.com/images2/Atrial_Natriuretic_Peptide_AF3366_Western_Blot_12960.jpg)
![Immunohistochemistry Atrial Natriuretic Peptide/ANP Antibody [Unconjugated]](https://images.novusbio.com/images2/Atrial_Natriuretic_Peptide_AF3366_Immunohistochemistry_14706.jpg)
![Immunocytochemistry Atrial Natriuretic Peptide/ANP Antibody [Unconjugated]](https://images.novusbio.com/images2/Atrial_Natriuretic_Peptide_AF3366_Immunocytochemistry_14709.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")