TCP1 alpha Antibody

Images

 
Western Blot: TCP1 alpha Antibody [NBP1-88149] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunohistochemistry-Paraffin: TCP1 alpha Antibody [NBP1-88149] - Staining of human testis shows strong nuclear and cytoplasmic positivity in cells in seminiferus ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TCP1 alpha Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VRYINENLIVNTDELGRDCLINAAKTSMSSKIIGINGDFFANMVVDAVLAIKYTDIRGQPRYPVNSVNILKAHGRSQMESMLISGY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TCP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TCP1 alpha Protein (NBP1-88149PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TCP1 alpha Antibody

  • CCT1T-complex protein 1 subunit alpha
  • CCTa
  • CCT-alpha
  • D6S230E
  • tailless complex polypeptide 1
  • t-complex 1
  • T-complex protein 1, alpha subunit
  • TCP-1-alpha

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-77397
Species: Hu, Mu, Rt, Ha, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP1-88146
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13798
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-74633
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP1-86562
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02043
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-33583
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30036
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP1-88145
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-919
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP1-86690
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00022948-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-46114
Species: Hu
Applications: WB, IHC, IF

Publications for TCP1 alpha Antibody (NBP1-88149) (0)

There are no publications for TCP1 alpha Antibody (NBP1-88149).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TCP1 alpha Antibody (NBP1-88149) (0)

There are no reviews for TCP1 alpha Antibody (NBP1-88149). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TCP1 alpha Antibody (NBP1-88149) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TCP1 alpha Products

Bioinformatics Tool for TCP1 alpha Antibody (NBP1-88149)

Discover related pathways, diseases and genes to TCP1 alpha Antibody (NBP1-88149). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TCP1 alpha Antibody (NBP1-88149)

Discover more about diseases related to TCP1 alpha Antibody (NBP1-88149).
 

Pathways for TCP1 alpha Antibody (NBP1-88149)

View related products by pathway.

PTMs for TCP1 alpha Antibody (NBP1-88149)

Learn more about PTMs related to TCP1 alpha Antibody (NBP1-88149).
 

Research Areas for TCP1 alpha Antibody (NBP1-88149)

Find related products by research area.

Blogs on TCP1 alpha

There are no specific blogs for TCP1 alpha, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TCP1 alpha Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TCP1